KEGG   Vibrio anguillarum NB10: VANGNB10_cII0521cHelp
Entry
VANGNB10_cII0521c CDS       T03657                                 

Definition
(GenBank) putative plasmid stabilisation system protein,Rorf_35
  KO
K06218  mRNA interferase RelE/StbE
Organism
vau  Vibrio anguillarum NB10
Brite
KEGG Orthology (KO) [BR:vau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:vau02048]
    VANGNB10_cII0521c
Prokaryotic defense system [BR:vau02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   RelE/StbE-RelB/StbD
    VANGNB10_cII0521c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParE_toxin ParE-like_toxin
Motif
Other DBs
NCBI-ProteinID: CDQ48418
UniProt: A0A241NM02
LinkDB All DBs
Position
2:complement(577943..578230)
Genome map
AA seq 95 aa AA seqDB search
MTYKLKFLPAAKKEWSKLAPPIQSQFKKKLKERLENPHVPSSKLRGYDSVYKIKLRTAGY
RLAYEVIDDEIVVYVLAIGKRDKDAVYKKLASRFS
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgacttataagctaaaatttctaccggctgccaagaaagagtggagtaagttagctcca
ccaattcaaagtcagttcaaaaagaagcttaaagagcgtctggaaaacccgcatgttcct
tcttctaaactgcgtggctatgactcagtttataagatcaaactacgtacagcaggctat
cgcttagcctatgaagtcattgatgatgaaatcgtggtgtacgtgttagctattggaaaa
cgagataaagatgcagtgtacaaaaagttagcatcaaggttctcgtaa

DBGET integrated database retrieval system