KEGG   Vibrio anguillarum NB10: VANGNB10_cII0549Help
Entry
VANGNB10_cII0549  CDS       T03657                                 

Definition
(GenBank) peptide methionine sulfoxide reductase
  KO
K12267  peptide methionine sulfoxide reductase msrA/msrB [EC:1.8.4.11 1.8.4.12]
Organism
vau  Vibrio anguillarum NB10
Brite
KEGG Orthology (KO) [BR:vau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VANGNB10_cII0549
Enzymes [BR:vau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     VANGNB10_cII0549
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     VANGNB10_cII0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMSR SelR TypeIII_RM_meth
Motif
Other DBs
NCBI-ProteinID: CDQ48446
UniProt: A0A241PA07
LinkDB All DBs
Position
2:607151..608284
Genome map
AA seq 377 aa AA seqDB search
MKRFTPFIFSIALIVPILFSLFSQAETQPKTMPSIGNQQIATLAGGCFWCTESDLEKLNG
VISVVSGYAGGSLENPTYKQVSSGKSGHIEVIQVTFDPQVVSYENVLDHFFRHIDPTDDQ
GSFVDRGPQYRPAIFYHNSEQKQTAQRFMQEIDALGIFKKPLKTELIQYSQFWPAEEYHQ
DFYKKSKVRYTYYRHASGRDQYLDTIFGKDRNEHPKTLRQLIEAQKMQNNVKVYTKPSNE
KIRAKLTDLQYYVTQEEGTERAFNNEYWDNKADGIYVDVVSGEPLFSSTDKYRSGTGWPS
FTRPINEAYIATKSDSRLFYTRTEVRSRFADSHLGHVFEDGPAPTGLRYCMNSAAMRFVP
KEAMQAEGYGEYLVLFK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttttactccctttatattctcaatagcacttattgtgcctattctgttttcg
ctatttagccaagcagaaactcagcctaaaaccatgcccagcattggtaatcagcaaatc
gcgacattagctgggggctgtttttggtgtacagaatctgatcttgaaaaactcaacggt
gtcattagcgttgtctctggttatgcgggtggcagccttgaaaatccaacctataaacaa
gtctcatcaggaaaatcgggccacattgaagtgattcaagtgacctttgatccgcaagtt
gtcagctacgaaaatgtattggatcattttttccgacacattgatccgacagatgatcaa
ggctcgtttgttgatagaggcccacagtatcggcctgccattttttatcacaacagtgaa
cagaagcagaccgcgcagcgttttatgcaagaaatcgatgcgctagggatcttcaaaaag
ccgctcaaaacagagctgattcaatatagccaattttggcctgctgaagagtaccaccaa
gacttttataaaaagagcaaagtacgttacacctactaccgtcatgcttccggacgtgac
caatatcttgataccatcttcggtaaagatcgtaatgagcatccaaaaaccttacgtcaa
ttgatcgaagcacaaaaaatgcaaaacaacgttaaggtatacaccaaaccttcgaatgaa
aagatacgcgccaaattgactgatttgcaatattacgtgacgcaagaagaaggtactgaa
cgcgcatttaacaatgagtattgggataacaaagccgatggtatttatgtcgatgtagtc
agcggagagccattattctcttctaccgacaaataccgttctggtacgggctggcccagt
tttactcggccaattaatgaagcgtatattgcgaccaaaagcgattctcggcttttttat
accagaaccgaagtgcgcagccgttttgcagattctcacctaggtcatgtctttgaggat
ggaccagcaccaaccggcttacgctactgcatgaactctgccgcgatgcgatttgtacca
aaagaagcgatgcaagctgaaggctatggcgagtacttggttctgtttaaataa

DBGET integrated database retrieval system