KEGG   Verrucomicrobia bacterium IMCC26134: IMCC26134_00575Help
Entry
IMCC26134_00575   CDS       T03830                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
vba  Verrucomicrobia bacterium IMCC26134
Pathway
vba00970  Aminoacyl-tRNA biosynthesis
vba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IMCC26134_00575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vba03029]
    IMCC26134_00575
Enzymes [BR:vba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IMCC26134_00575
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IMCC26134_00575
Mitochondrial biogenesis [BR:vba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IMCC26134_00575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AKC81640
UniProt: A0A0E3UHF1
LinkDB All DBs
Position
160604..160882
Genome map
AA seq 92 aa AA seqDB search
MQIDIDHLAMLSRLALTPEEKVKFSAQLGDIIGYIEKLKEVNVDGVEPTAHATPIFNVLQ
ADDPRPGLSVEDALRNAPVQRDHMVVVPRVVE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcagatagacatcgaccaccttgccatgctctcccgcctggcgctcacccccgaggaa
aaggtaaaattctccgcccagctcggcgacatcattggttacatcgagaaactcaaggaa
gtgaacgtggacggcgtcgagcccaccgcgcatgccacgcccattttcaacgttctccaa
gccgacgacccacgccccgggctctcggtcgaagacgccctccgcaacgcccccgtccaa
cgcgaccacatggtcgttgtcccccgcgtcgtcgaataa

DBGET integrated database retrieval system