KEGG   Verrucomicrobia bacterium IMCC26134: IMCC26134_09670Help
Entry
IMCC26134_09670   CDS       T03830                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
vba  Verrucomicrobia bacterium IMCC26134
Pathway
vba00052  Galactose metabolism
vba00511  Other glycan degradation
vba00600  Sphingolipid metabolism
vba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    IMCC26134_09670
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    IMCC26134_09670
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    IMCC26134_09670
Enzymes [BR:vba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     IMCC26134_09670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AKC84055
UniProt: A0A0E3UK75
LinkDB All DBs
Position
2542053..2544638
Genome map
AA seq 861 aa AA seqDB search
MPTLVNATVAPVSREILPFDSGWRFHRHDPEPVGTDLSREALRAWLLPQTDTFSNYLPAP
HSRPASPEPGASLSVIQQGYDDSTWRTLDLPHDWAIEGPFDQSLPGETGKLPWTGTGWYR
KTFALPAGDAGRHLTLEIDGAMSHSAVWLNGRFVGGWPYGYTSFQLNLTPYARPGADNIL
VIRLDSPPDSSRWYPGAGLYRHVRLVKTNPVRIAPWGVFVTTPAISEKSATVDVRIEIDN
HAAESAKLAVAVALQEIDLAGRPVAAPVAVAKPQQLEIKAGLPRQTSFNLSVPSPLLWSP
ASPRRYVAVATLHKDGVLIDRVETPFGIRSLVNDPDRGLILNGEPVRLHGVCMHHDIGAL
GAAVNVTALERQLRIMREMGANSIRTSHNPPTPELLDLCDQMGLLVMAESFDAWALPKKK
NDYSVDFPWWHEADLRALVRRDRNHPSVVMWSIGNEIVEQFNSVGWKLATRLAGLVREED
RTRPITAGFNHTWSGYNGFQTAVDIVGFNYKPGEYPTFRAAHPRIAVLGAETASTISSRG
EYMFPVTNNQAAGAADFQVSSYDLSAPRWATTPDREFAAQDDNPAVLGEFVWTGFDYLGE
PTPYNDDSTNLLNYSNPADRERAAKELAALGKIRVPSRSSYFGIVDLAGFPKDRYYLYQA
RWRPELAQAHLLPHWSWPGREGQVTPVHLYTSGDEAELFLNGVSLGRKKRGPHDYRLRWD
DVVYQPGELRAVAYKNGAVWAEAVQRTAGIAATLQLTPERATLAADRRDLAFVTVRVLDA
AGVLVPRAKDALTFEVSGPADLIATDNGDATSFESFQAPARKAYNGLALVILRTRPGQTG
EITLTARATGLPATSLKLRSE
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgcctacccttgtcaacgccaccgtcgcgcccgtcagccgcgagattttacccttcgac
tccggatggcgcttccaccgccacgacccagagccagtcggcaccgatctctcccgcgag
gccttgcgggcctggctgctgccccagacggatactttctccaactatctgcccgcgcct
cattcgagacctgcttcaccggagccgggtgcgtcactctccgtcatccagcaaggttac
gacgattccacatggcgaaccctcgatctgccgcatgattgggccatagaaggcccgttc
gaccagtctctgcctggtgaaaccggtaaactgccttggaccgggaccggttggtatcgt
aaaaccttcgccttgcccgccggcgacgcaggccgccacctcacactcgagatcgacggc
gccatgtcgcactccgccgtctggttgaacggtcgcttcgtcggcggctggccctacggc
tacacttccttccagcttaaccttactccctatgcccgccccggtgcggacaacatcctc
gtcatccgcctcgacagtccgcccgactcctcgcgctggtatcccggcgccgggctttat
cgtcacgtccgtctggtcaaaaccaaccccgttcgcatcgcgccgtggggcgtcttcgtc
accactcccgccatctccgaaaaatccgccaccgtcgatgtccgcatcgagatcgacaac
catgccgccgagtcggccaagctggccgtcgctgtagctctgcaagaaattgacctcgca
gggcggccggtcgctgcccccgtcgccgtcgccaaaccgcaacagcttgagattaaggcc
ggtctcccgcgccagacttccttcaacctttccgtgccttcgcccctgctctggagtccg
gccagtccgcgtcgctacgtggcggttgccaccctgcataaagacggcgtgctcatcgat
cgcgttgagaccccctttggcatccgcagcctcgtcaacgaccctgatcggggcctcatt
cttaacggcgaaccggtccgcctgcacggcgtctgcatgcatcacgatatcggcgcgctc
ggagcggccgtcaacgtcaccgcactcgaacgccagctccgcatcatgcgcgagatgggg
gccaactccatccgcacctcgcacaatccccccacccccgagcttctcgatctctgcgac
cagatgggcttgctcgtcatggccgaatccttcgacgcctgggccttgcccaaaaagaaa
aacgactactcggtcgattttccgtggtggcatgaagccgatctgcgcgccttggtgcgc
cgcgaccgcaaccacccctccgtggtcatgtggagcataggcaacgagatcgtcgagcaa
ttcaactccgtcggctggaagctcgccacccgtctcgccggcctggtccgcgaagaggac
cgcacccgcccgatcaccgccgggtttaaccacacctggtccggctacaatggcttccag
accgccgtcgatatcgtcggcttcaactataaacccggtgagtatcccaccttccgcgcc
gcccaccctcgtatcgccgtgctcggcgccgagacggcctccaccatcagttcgcgcggc
gaatacatgttcccggtcaccaacaaccaggccgccggcgcagccgacttccaggtcagc
agctacgatctctccgccccgcgctgggccaccacgccggaccgtgaattcgccgcacag
gacgacaatccggccgtcctcggcgagttcgtctggaccggcttcgattacctcggagag
cccaccccctataacgacgattcaaccaacctgctcaactactccaaccccgccgaccgt
gagcgcgccgccaaggaactcgccgccctcggcaagatccgcgtgccttctcgttccagc
tacttcggcatcgtcgatctggccggcttccccaaagaccgctactacctctaccaggcc
cgctggcgcccggagctcgcccaggcccacctccttcctcactggagctggccgggacgc
gagggtcaggtgacacccgtccacctctacacctcgggtgacgaggctgaactttttctc
aatggtgtctcgctcggtcgcaagaaacgcggcccgcacgactaccgtctccgctgggac
gacgtcgtctaccagcccggcgaacttcgtgccgtcgcctacaaaaacggtgcggtctgg
gccgaagccgtccagcgcaccgcaggcatcgcggcgaccctgcaactcacccccgagcgc
gccaccctcgcagccgaccgccgcgatctggccttcgtcaccgtgcgggtgctcgacgcc
gccggcgtgctcgtgccgcgcgcgaaggacgcgttgaccttcgaggtttccggacccgcc
gacctcatcgccaccgacaacggtgatgccaccagcttcgagagcttccaagcccccgcc
cgcaaagcctacaacggcctcgcgctggtcatcctacgcacccgccccggccagacgggc
gagatcacgctcaccgcccgcgccaccggcctgcccgccacctccctaaaactccgctcc
gagtaa

DBGET integrated database retrieval system