KEGG   Verrucomicrobia bacterium IMCC26134: IMCC26134_13410Help
Entry
IMCC26134_13410   CDS       T03830                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vba  Verrucomicrobia bacterium IMCC26134
Pathway
vba00564  Glycerophospholipid metabolism
vba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    IMCC26134_13410
Enzymes [BR:vba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IMCC26134_13410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 HI0933_like Pyr_redox_3 GIDA Pyr_redox Fer2_BFD
Motif
Other DBs
NCBI-ProteinID: AKC83520
UniProt: A0A0E3UJI2
LinkDB All DBs
Position
complement(3508458..3509987)
Genome map
AA seq 509 aa AA seqDB search
MNRPALLQGLRTGETFDLLVIGGGATGLGTALDAVARGYTVALLERGDFACGTSSRSTKL
VHGGVRYLSQGNISLVRSSLRERGRLARNAPHLVRKLAFVIPAYSVTDWLFYGAGLKLYE
ALAGACSLGPSRVLDRTATLARLPNVESTGLRGGVLYHDAQFDDARLALTLARSAADRGA
VLLNHADVTAFVREGSRVVGVEVLDLISGAEFTVRARAVINATGVFVDALRRLEDAACAP
LVTVSQGIHLVLPRRFLPGGSALMVPKTDDGRVLFAVPWHDRVIVGTTDTPRPVAETEPR
ALPEEIAFVLSHARRYLAEDPTQADVLSVFAGQRPLVRGQAGAATSRLSREHALEVGTGG
VLTVTGGKWTTYREMAEQVVDLAARLGGLPPAASITADLRLRGAGENIRTVYGDDEPAVF
ASGAGAPLHPNLPYTEAEVRWAARHELAETVEDVLSRRTRALLLDARAASGCAPRVAEIL
AEELGRDAAWAEKQVAAFRELAAGCTPNA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtccagccctgttgcaaggcctgcggacgggggaaacctttgacctgctcgtc
atcggcggcggggccaccggccttggcaccgcactcgatgcggtcgcgcgcggttacacg
gtcgccctgctcgaacgcggcgacttcgcctgcggcacttccagtcgttcgaccaagctg
gtccacggcggggtgcgttatctgagccagggcaacatcagcctcgtgcgctcctccttg
cgcgaacgcggccggctcgcgcgcaacgcgccccacctcgtgcgcaagcttgcctttgtc
attcccgcctactccgtgaccgactggctcttctatggcgccggcctgaaactctacgaa
gccctggcgggtgcgtgttcgctcgggccttcgcgggtgctcgaccgcaccgccactctt
gcccgtctgcccaatgtggaatcaaccggcttgcgaggcggcgtgctttaccacgatgcg
cagttcgatgacgcccgtctcgcgctcacgctcgcccgcagcgcggcggatcgcggcgct
gtcctgctcaaccacgccgacgtcacggctttcgtccgcgaaggaagccgggtcgttgga
gttgaggtgctcgatcttatcagcggagccgagttcacggtgcgggcgcgcgccgtcatc
aacgccaccggcgtgtttgtggatgccctgcgccgccttgaagatgccgcctgcgcacca
ctggtgacggttagccagggcatccacctcgtgctgccccgccggtttctgccgggcggc
tccgctctcatggttccgaagaccgacgacggtcgcgtgcttttcgccgtgccttggcac
gaccgcgtcatcgtcggcaccaccgacactccgcgcccggtggcggagacagagccgcgt
gcgctgcccgaggaaatcgccttcgtgctctcccacgcccggcgctatctcgccgaagac
ccgacgcaggccgacgtgttgagtgtctttgcgggacaacgaccgctggtgcgcggccag
gcgggcgccgccacctcccgtctctctcgtgaacacgcgctggaggtcggcaccggaggc
gtgctcaccgtcaccgggggaaagtggaccacttatcgtgaaatggccgaacaggtcgtc
gatctggctgcccgtctcggcggactgccgcccgcggcttcgatcaccgccgacctccgc
ttgcgcggcgcgggagaaaatatccgcacggtttacggtgacgacgagcccgccgtgttt
gcttcgggtgcgggcgcgccgctgcatccgaacctgccctacaccgaggcggaggtccgc
tgggccgcccgtcacgagctcgccgagacggttgaagatgtgctttcccgtcgcacccgg
gccctgctgctcgatgcccgcgccgcgtccgggtgcgcgccgcgcgtggcggagatcctc
gccgaagagctcggccgtgacgcggcgtgggcggagaagcaagtggcggcgtttcgtgag
ctggcggcgggctgcacgcccaacgcgtaa

DBGET integrated database retrieval system