KEGG   Victivallales bacterium CCUG 44730: C5Q97_00005Help
Entry
C5Q97_00005       CDS       T05502                                 

Definition
(GenBank) hypothetical protein
  KO
K04083  molecular chaperone Hsp33
Organism
vbc  Victivallales bacterium CCUG 44730
Brite
KEGG Orthology (KO) [BR:vbc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:vbc03110]
    C5Q97_00005
Chaperones and folding catalysts [BR:vbc03110]
 Heat shock proteins
  HSP33
   C5Q97_00005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AVM47152
UniProt: A0A2S0L1I5
LinkDB All DBs
Position
complement(join(5242245..5242681,1..454))
Genome map
AA seq 296 aa AA seqDB search
MEHVAQDYLSYAVVKEEAVRLAVGSFRELASETIIRHDADPVAGRLLADAFSSAALTGTM
LGRGERLSVRFGYAGPAGSIVVDAGSDGCLRGFIRNPHVMEEADSVEVACGEDGATVRST
RSRHGRILRSGESKSAFILPSSALAYHLSVSEEIESELRCEIELQADPAEPVKSAPGVLL
QAMPGCDLSGFDHMRRKLQMPEAGEILRTRFGSAPEEGVRLLLAFLLERMDLPAFQLQPL
PAARFHCGCSAEALRKTALQILGREEIEKLLAENPNPALRCQFCNTEYHFSAADLP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgtcgcgcaggattacctgagctatgcggttgtgaaagaagaggccgtccgc
cttgccgtcggcagtttccgggagctggcctcggagacgatcatccgccacgatgccgat
ccggtcgccggacggctgctggccgacgccttctcctccgccgcgctgacgggaaccatg
ctcgggcgcggggagcgtctgtcggtccggttcggttatgcgggtccggccggttcgatc
gtcgtcgacgccggttcggacggatgcctccgcggcttcatccgcaatccgcacgtcatg
gaagaggccgattcggtcgaagtcgcctgcggggaagatggagcgacggtccggagcacc
cgctcccggcacggcaggattctccgctccggcgagtcgaaaagcgctttcattctgccc
tcctccgcgctggcttaccatctctccgtcagcgaggagatcgaaagcgagctccgctgc
gagatcgagctgcaggcagacccggccgaaccggtgaaaagcgcgcccggggtcctcctg
caggccatgccgggctgcgacctgtccgggttcgaccacatgcgccggaaacttcagatg
ccggaagcgggcgaaatcctccgcacccggtttggaagcgccccggaagagggcgttcgc
ctccttctggcgttcctgctcgaacgcatggatctccccgccttccagctgcagccgctg
cccgcggcccgttttcactgcggctgttcggcggaagcgctccggaaaaccgcgctgcag
attctcgggcgggaggagatcgaaaagcttctggcggaaaatccgaatccggcgctccgc
tgtcagttctgcaatacggaataccacttttccgccgccgatcttccgtaa

DBGET integrated database retrieval system