KEGG   Victivallales bacterium CCUG 44730: C5Q97_18985Help
Entry
C5Q97_18985       CDS       T05502                                 

Definition
(GenBank) hypothetical protein
  KO
K17680  twinkle protein [EC:3.6.4.12]
Organism
vbc  Victivallales bacterium CCUG 44730
Brite
KEGG Orthology (KO) [BR:vbc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vbc03029]
    C5Q97_18985
Enzymes [BR:vbc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     C5Q97_18985
Mitochondrial biogenesis [BR:vbc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    C5Q97_18985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 DnaB_C Toprim_2 AAA_25 ATPase Toprim FtsK_SpoIIIE Toprim_3 Sex_peptide zf-CHC2
Motif
Other DBs
NCBI-ProteinID: AVM46684
UniProt: A0A2S0L0C6
LinkDB All DBs
Position
complement(4630324..4632072)
Genome map
AA seq 582 aa AA seqDB search
MSHFSDFGIDLPDHFSGDRKVLCPKCSASRKKSKDPCLSVNGETGMWHCHNCGWSGKLNE
SEAPALPPRKTYRRPSAELVGSNIDPRIIDYFANRGIGANALAKAKVYSTWHWLPGTGEE
TLCIAFPFYKDGELINVKYRDARKNMAQEKDPEPCLWNIDACKKAETIYITEGEIDALTL
IECGFSTAVSVDKGAPQPNDSDATKKLECVANCIEILENADAVVLVTDKDEPGLRLEKEL
IDRIGPAKCRLVTYPEGCKDINEVLTRCGSGAVVKAITAAVPAPVPGLRQMAEFRANIEN
YYRKGKPRGLTTGYPDFDRYFTFQPGSVNLVTGIPQSGKSEFVHQLVVNAIRLHDWKAAV
FSPEMLPVENLFANFAEKLSGKPFFGPGEERMSWQEMQDTLAKVDEYIKVILPDADKTPT
LDELLAAAQVCVTRYGVKVFVIDPYNEIEHTRTQWMSETEYISYFMARLRKFARQNGVVV
FLVAHPTKLKKDERTKKYPVATLYDIAGSANFANKTDNGLSLWRDPTAKSNIVQVHILKI
KNKHIGRANTHQEFEWNRKNGRFSIPAPYPESAEPPPTEGRN
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcacttttcagatttcggaatcgatttgccggatcatttttccggcgaccggaaa
gtgctgtgcccgaagtgcagcgcttcccggaagaagtcgaaagacccgtgcttgtcagtg
aacggcgaaaccgggatgtggcactgccacaactgcggctggtcgggaaagctgaacgaa
tcggaagccccggcgctcccgccccggaaaacgtaccggcggccgagtgcggagctggtc
ggctcgaacatcgatccgcggatcatcgactacttcgcaaaccgcgggatcggtgcgaat
gcgctggccaaggccaaagtttactcaacctggcactggctgccaggaaccggcgaggaa
acgctctgcattgcgtttccgttttacaaagacggcgaactcatcaacgtcaagtaccgt
gacgcccggaagaacatggcgcaggagaaggacccggagccgtgtttgtggaacatcgac
gcctgtaaaaaggcggagaccatctacatcaccgaaggcgagatcgacgccttgactctg
atcgagtgcgggttttcaaccgccgtttcggtggataaaggcgcgccgcagccgaacgat
tcggatgcgaccaagaaactcgaatgtgtggccaactgcatcgagatcctcgaaaacgcg
gacgcggtggtgctggtgacggacaaggacgagccgggcctccggctggaaaaggaactg
atcgaccggatcggcccggcgaagtgccgcctggtcacctacccggagggctgtaaggac
atcaacgaagtgctgacgcgctgcggatcgggcgcggtggtgaaggcgatcaccgcggcg
gttccggcgccggtgcctggcctgcgccagatggcggagttccgggcgaacatcgagaat
tactaccggaagggcaagccgcgcggcctgactaccggctatccggacttcgaccgctat
ttcaccttccagcccggatcggtgaatctcgtgaccggcatcccgcagtcgggcaagtcg
gagttcgtgcaccagcttgtggtgaatgcgatccggctgcacgactggaaagcggcggta
ttcagcccggagatgctgccggtcgaaaacctgtttgcgaacttcgcggaaaagctgagc
ggcaaaccgtttttcggccctggcgaagagcggatgagctggcaggagatgcaggacacg
ttggccaaggtcgatgagtacatcaaggtaatcctgccggacgcggacaagacgccgacg
ctggacgagctgctggctgcggcgcaggtctgtgtgacgcggtatggcgtcaaggtgttt
gtgatcgacccttacaacgagatcgagcatacccgcacccagtggatgagcgagaccgag
tatatcagctacttcatggccaggctgcggaagttcgcccggcagaacggcgtggtggta
ttccttgtcgcgcaccctaccaaactcaaaaaggatgagaggacgaaaaaatatccggtc
gcaacgctgtacgacatcgcgggcagcgcgaattttgcgaacaagaccgacaacgggctc
agcctgtggcgtgacccgaccgcgaaaagcaacatcgttcaggtgcacatcctgaagatc
aagaacaaacacataggccgcgcgaatacgcaccaggaattcgagtggaaccggaaaaac
ggccggttcagtattcctgcgccgtatccggaatcggccgaaccaccaccaacggaggga
cgaaattga

DBGET integrated database retrieval system