KEGG   Verrucomicrobia bacterium HZ-65: CMV30_09300Help
Entry
CMV30_09300       CDS       T05426                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
vbh  Verrucomicrobia bacterium HZ-65
Pathway
vbh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CMV30_09300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vbh03400]
    CMV30_09300
Enzymes [BR:vbh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CMV30_09300
DNA repair and recombination proteins [BR:vbh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CMV30_09300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ATC64134
UniProt: A0A290Q6K7
LinkDB All DBs
Position
complement(2293536..2295170)
Genome map
AA seq 544 aa AA seqDB search
MSLQEYRRKRNFKKTAEPAPKVDRQNRRRFVIQKHDATRLHYDFRLELGGTLKSWAVPKG
LPLAHGDKRLAVHVEDHPVSYIAFEGTIPKGQYGGGTVMLWDEGIFETDDPHPLKTLEKG
KLHFTLKGKKLKGAWYLVRLRDSDEWLIIRGGDDHKPISKKLDDTSVRSKKSMAQLAKSD
RVWESKPINDSSLKTRLQKLAAKPEARKTEPTKPKRKSGPAPKFIAPMQALLVDEPERSG
EWLYEIKFDGFRALAFKHGDSVHLLSRNEKDFAEKFPEIADAMAELAIDDAILDGEIVAL
NKKGLSSFQLLQGLEDGERPPLYFYVFDLLQLDGQSLLNQPLTERKAALEKLLRKPPAAI
RYSASLTGKLPALMKRVQHLGLEGLIGKRPGSLYEPGKRSGAWIKLKISHEQEFVIGGYT
PPAGSRKHLGALIVGVYENKKLICTGKVGTGFNHALLKSLHTRFAKIARKECPFDNLPDK
RERRFGQAITASVMKKCHWVKPELVAQLRFTEWTNDGRLRHPVFLGLREDKKATDVVREK
PART
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctccaagaatatcgccggaagcggaatttcaaaaaaaccgccgagcccgcacct
aaggtcgaccgccagaatcgccgccgcttcgtcatccagaaacacgacgccacccgcctc
cactacgacttccgcctcgaactcggcggcacgctcaaatcctgggccgtccccaaaggc
cttccgctcgcgcacggcgacaaacgcctcgccgttcacgttgaggatcaccccgtttcc
tacatcgccttcgaaggcaccatccccaaaggccagtacggcggcggtaccgtcatgctc
tgggacgaaggcatcttcgagaccgacgacccgcatccgctcaagactctcgagaaagga
aaactccacttcaccctcaaaggcaaaaaactcaaaggcgcctggtacctcgtgcgcctg
cgcgacagcgacgagtggctgatcattcgcggtggcgacgatcacaaaccgatctccaaa
aaactagacgacacgtccgtccgctcgaaaaaatccatggcgcaactcgcgaagagcgat
cgcgtttgggaatcgaagcccatcaacgactcctcgctaaaaactcgtcttcaaaaactc
gccgcaaaaccggaggccaggaagaccgagcccacgaaaccgaaacgcaaaagcggcccc
gccccgaaattcatcgcccccatgcaggcgctcctcgtcgacgagcccgaacgcagcggc
gaatggctctacgaaatcaaattcgacggcttccgcgccctcgccttcaaacacggcgac
tccgtccacctcctctctcgaaacgaaaaagacttcgccgaaaaattccctgagatcgcc
gacgccatggctgaactcgccattgatgacgcgatcctcgacggcgaaatcgtcgccctg
aacaaaaaaggcctatcctcattccagctcctccaaggcctcgaagacggcgagcgcccg
cctctctacttctacgtgttcgatctcctccagctcgacggccaaagcctcctcaaccag
ccgctcaccgagcgcaaagccgccctcgaaaaactcctgcgcaaaccgcccgccgcgatc
cgttactctgcatcgctcacaggaaaactccccgcgctcatgaagcgcgtccaacacctc
ggcctcgaaggcctcatcggcaaacgccccggctcgctctacgaacccggcaagcgctcg
ggtgcgtggataaaattaaaaatctcgcacgaacaggaattcgtcatcggcggctacacg
ccgcccgctggtagccgcaagcatctcggcgcgctcatcgtcggcgtctacgagaacaaa
aaactcatctgcaccggcaaggtcggcaccggcttcaaccacgcgctgctcaaatcgctc
cacacccgcttcgccaaaatcgcccgcaaagaatgccccttcgacaacctccccgataaa
cgcgagcgccgcttcggccaggccatcaccgcgtccgtcatgaagaaatgccactgggtg
aagcccgaactcgtcgcccaactccgcttcaccgaatggaccaacgacggtcgcctccgc
caccccgtcttcctcggcctccgcgaagacaaaaaagccaccgacgtcgtccgcgaaaaa
cccgcccgcacatga

DBGET integrated database retrieval system