KEGG   Nibricoccus aquaticus HZ-65: CMV30_16020
Entry
CMV30_16020       CDS       T05426                                 

Definition
(GenBank) histidine kinase
  KO
K02482  two-component system, NtrC family, sensor kinase [EC:2.7.13.3]
Organism
vbh  Nibricoccus aquaticus HZ-65
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vbh01001]
    CMV30_16020
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vbh02022]
    CMV30_16020
Enzymes [BR:vbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CMV30_16020
Protein kinases [BR:vbh01001]
 Histidine kinases
  NtrC family
   CMV30_16020
Two-component system [BR:vbh02022]
 NtrC family
  Unclassified
   CMV30_16020
SSDB
Motif
Pfam: HATPase_c PAS_4 PAS HATPase_c_5 PAS_9 HATPase_c_3
Other DBs
NCBI-ProteinID: ATC65331
UniProt: A0A290QLJ9
LinkDB
Position
complement(3964058..3965425)
AA seq 455 aa
MSQHPDAPPAVPAAMTGSGSPIPQIESLLLQAFLASIPDHIYFKDLQSRFLAVSQAKATR
DNLTPAQLIGKTDFDFFAEAHARKAYDDEQAIIRTGQPMLDKLEKETWPDGRVTWVLTSK
LPLRDDLGKVIGTFGISKDVTKSVETQKALEEANLQLMEATRQAGMAEVATGVLHNVGNV
LTSINVTANLLSDRFRDSKVTSIFKVCALLRDQSADLPGFFAKDPRGAKLPGYLENLANA
LDQERTETMSDLGTLLKSIDHVKDIIWMQQSYASVAGVVEPLALNEAIEDAIKLSNNALL
RHNVHVTREFAITPPARAERHKVLQILVNLISNAKKAMDVKEPSQRRMILRIENTPQNTV
QIKVIDNGVGIPPDNLTKIFSHGFTTRKDGHGFGLHSSANAAKQMGGSLSAFSQGPGKGA
TFVLELPAWKEGESNSLAVKSAEQAFAPISAARSV
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgagccagcaccccgacgccccgcccgccgttcccgccgccatgaccggctccggctcc
cccattccccagatcgaaagcctcctccttcaggcgtttctggccagcatccccgaccac
atttatttcaaagacctccagtcgcgattcctcgccgtcagccaggccaaggccactcgc
gataacctcacgcccgcccagctcatcgggaaaaccgacttcgacttcttcgccgaggcc
cacgcccgcaaagcctacgacgacgagcaggccatcatccgcaccggccagccgatgctc
gataaactggaaaaagaaacctggcccgacggccgcgtcacctgggtgctcaccagcaaa
ctcccgctccgcgacgacctcggcaaagtcatcggcaccttcggcatcagcaaagacgtc
accaaatccgtcgagacccagaaagccctcgaagaggccaatctccagctcatggaggcc
acccgccaggccggcatggccgaggtcgccaccggcgtcctccacaacgtcggcaacgtc
ctcacgagcatcaacgtcaccgccaatctcctctccgaccgcttccgcgattcgaaggtc
acgagcatcttcaaagtctgcgccctcctccgcgatcaatccgccgatctccccggcttc
ttcgccaaagatccgcgcggcgcgaaactccccggctatctcgaaaatctcgccaacgct
ctcgatcaagagcgcaccgaaacgatgtccgacctcggcacgcttctgaagagcatcgat
cacgtgaaagacatcatctggatgcagcagagctacgcctccgttgccggtgtcgtcgaa
ccgctcgcgctcaacgaagccatcgaggacgcgatcaagctcagcaacaacgcgctcctc
cgccacaacgtccacgtcactcgcgaattcgccatcaccccgcccgcccgcgccgagcgc
cacaaggttctccaaatcctcgtgaacctcatcagcaacgccaagaaggcgatggacgtg
aaagaaccctcccagcgccgcatgatcctgcgcatcgaaaacacgccgcaaaacaccgtt
cagatcaaagtcatcgacaacggcgtcggcatcccgccggacaacctcacgaagatcttc
tcccacggcttcaccacgcgcaaagacggccacggcttcggcctccactcgagcgccaac
gccgccaaacaaatgggcggctccctcagcgccttcagccaaggccccggcaaaggcgcc
accttcgtcctcgaactccccgcgtggaaggaaggcgaaagcaacagcctcgccgtcaaa
tccgccgaacaagccttcgccccgatctcggcagcgcgctcggtgtga

DBGET integrated database retrieval system