KEGG   Kiritimatiella glycovorans: L21SP4_00130Help
Entry
L21SP4_00130      CDS       T04225                                 

Gene name
pfp_1
Definition
(GenBank) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vbl  Kiritimatiella glycovorans
Pathway
vbl00010  Glycolysis / Gluconeogenesis
vbl00030  Pentose phosphate pathway
vbl00051  Fructose and mannose metabolism
vbl00052  Galactose metabolism
vbl00680  Methane metabolism
vbl01100  Metabolic pathways
vbl01110  Biosynthesis of secondary metabolites
vbl01120  Microbial metabolism in diverse environments
vbl01130  Biosynthesis of antibiotics
vbl01200  Carbon metabolism
vbl01230  Biosynthesis of amino acids
vbl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L21SP4_00130 (pfp_1)
   00030 Pentose phosphate pathway
    L21SP4_00130 (pfp_1)
   00051 Fructose and mannose metabolism
    L21SP4_00130 (pfp_1)
   00052 Galactose metabolism
    L21SP4_00130 (pfp_1)
  09102 Energy metabolism
   00680 Methane metabolism
    L21SP4_00130 (pfp_1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    L21SP4_00130 (pfp_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vbl01009]
    L21SP4_00130 (pfp_1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vbl03019]
    L21SP4_00130 (pfp_1)
Enzymes [BR:vbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     L21SP4_00130 (pfp_1)
Protein phosphatases and associated proteins [BR:vbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     L21SP4_00130 (pfp_1)
Messenger RNA biogenesis [BR:vbl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     L21SP4_00130 (pfp_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase DUF2067 DUF3551
Motif
Other DBs
NCBI-ProteinID: AKJ63416
UniProt: A0A0G3EAF1
LinkDB All DBs
Position
128414..129727
Genome map
AA seq 437 aa AA seqDB search
MNPDESMFRIVPTETLGPCRYDSPLGAMRQRFYTDGEWVIRRTRSHEFEELEGPPFECFE
RSGAREKLYFRPQDTTVGIVTCGGLCPGINDVIRAITFAAAEGYGVKQVLGFQYGYEGLV
AKYYHRPIELNPDNTDDIHEKGGSILKSSRGPQDTGEIVDTLQHYCVDILFAIGGDGTMR
GVRDIHDEIARRGLRISVIGVPKTIDNDISLVERTFGYETAVESAWSTITSAHAEAKGYR
NGIGLVKLMGRDSGWIAASTALANSNVNFCLIPEVPFDLEPPNGFLEHLRRRLMRRAHAV
IVVAEGAGQNLFEGEYERDKSGNKRLHDIGVLLQEQIERFFAEQNTEINLKYFDPSYLIR
STPANANDSEYCLRLGHNAVHAAMAGKTNCIVGLHCGVLVNLPMPMIGERKRVDPNGWTW
QSVLQATRQPADMTHEE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgacgagtccatgttccgcatcgtgccgaccgagacgctcgggccgtgccgc
tacgattcgcccctgggcgcaatgcgccagcggttttataccgacggggaatgggtgatc
cgccggacgcgcagccacgagttcgaggaactcgaaggtccccccttcgagtgcttcgag
cgatcgggcgcaagggagaagctctacttccgcccgcaggacaccacggtcggcatcgtc
acctgcggcggactctgcccgggcatcaacgacgtcatccgcgcgatcaccttcgcggcg
gcggagggctacggtgtgaaacaggtcctcggcttccagtacggctacgaggggctggtc
gccaagtactaccaccggccgatcgaactcaatcccgacaataccgacgacatccacgag
aagggcggatcgatcctcaagtcctcgcgggggccccaggacacgggggaaatcgtcgat
accctccagcactattgcgtcgacatcctgtttgccatcggcggcgacggaacgatgcgc
ggcgtgcgtgatatccacgacgagatcgcccggcgcggtctcaggatctcggtcatcggc
gtgccgaagacgatcgacaacgacatcagtctcgtggagcggaccttcgggtacgagacc
gcggtggagtcggcctggagcaccatcacgtccgcccacgcggaggccaagggctaccgg
aacggaatcggactggtgaaactcatgggccgcgactcaggctggatcgcggcctccacc
gcactcgcgaacagcaacgtcaatttctgcctgattcccgaagtgccgttcgatctcgag
cccccgaacgggttcctggaacacctgcgccgtcgtcttatgcggcgcgcccacgcggtg
atcgtggtcgcggagggtgcgggacagaacctgttcgaaggcgaatacgagcgcgacaag
tcggggaacaagcggctgcacgacatcggcgtacttcttcaggagcaaatagagcgattt
ttcgcggagcagaacacggagatcaatctgaagtatttcgatccgagctatctcatccgg
agcacgccggcgaacgcgaacgattcggagtactgcctgcggctggggcacaacgcggtt
catgcggcaatggccggcaagacgaactgcatcgtcgggctgcactgtggcgtgctggtc
aaccttcccatgccgatgatcggcgagcgcaaacgggtggaccccaacggctggacctgg
cagtcggtgcttcaggccactcgacagcccgccgacatgacccacgaagaatga

DBGET integrated database retrieval system