KEGG   Kiritimatiella glycovorans: L21SP4_00937Help
Entry
L21SP4_00937      CDS       T04225                                 

Gene name
gutB_1
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
vbl  Kiritimatiella glycovorans
Pathway
vbl00040  Pentose and glucuronate interconversions
vbl00051  Fructose and mannose metabolism
vbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L21SP4_00937 (gutB_1)
   00051 Fructose and mannose metabolism
    L21SP4_00937 (gutB_1)
Enzymes [BR:vbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     L21SP4_00937 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AKJ64199
UniProt: A0A0G3EJ33
LinkDB All DBs
Position
1104615..1105652
Genome map
AA seq 345 aa AA seqDB search
MKSMKLTGLRQMQMMEGPAPELVRDDDVLITMKAVGVCGSDVHYYETGRIGSQVVAYPFA
VGHEGAGEVAAVGTAVTKVKPGDRVAIDPANPCGTCDQCRAGRPHTCRHLTYLGCPKQAE
GCLSEQIVMPEDSCLPLPDDVSYEEAAISEPLSIGMYAVELSVPVPGTRIGILGAGPIGL
SVLLPARAQGAKAIYVTDKLDPRIALAKKAGATWGGHPDREDIVARVLEQEPGGLDVVFE
CCGEQDALDQAIDLLKPGGKLMLIGIPPTAERVSFEIDKLRHKEIAIQNVRRQNGCAQKA
IDLIAQRVFDVNLMTTHRFDFARTAEAFDLVAAYRDGVVKAMIHF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgatgaaattgaccggtttgcgtcagatgcagatgatggagggccccgcgccg
gaactcgtccgcgacgacgacgtgctgatcacgatgaaggccgtcggggtctgcggctcg
gacgtccattactacgagacgggacggatcggttctcaggtggtggcgtatcccttcgca
gtaggccatgagggcgcgggggaggtggcggctgtgggaacggcggtgacgaaggtgaag
cccggcgaccgcgtggcgatcgacccggcgaatccctgcggcacctgcgatcagtgccgg
gccggtcggccgcatacctgtcgtcatctgacctatctcggatgtccgaagcaggccgag
ggctgtctctccgaacagatcgtgatgcccgaagattcgtgtctcccgctgcccgatgac
gtgagctacgaagaggcggcgatctccgaaccgctctcgatcgggatgtacgccgtcgag
ctttccgtccccgtgccgggcacccggatcggcatcctcggggccggaccgatcgggctc
agtgtattgcttcccgcgcgggcgcagggggcgaaggcgatctatgtgacggataaactc
gatccccggatcgccctcgcaaagaaggccggggcgacgtggggcggccatccggatcgc
gaagatatcgtggcgcgcgtactcgaacaggaaccgggcggcctcgatgtcgtgttcgag
tgctgcggagaacaggacgccctcgatcaggcgatcgatctgctgaagccggggggcaaa
ctgatgctgatcgggattccgccgaccgcggagcgggtaagtttcgagatcgacaaattg
cgccacaaggagatcgcgattcagaacgtacgccgtcagaatgggtgcgcgcaaaaggcc
atcgacctgatcgcacagcgcgtgttcgatgtgaacctgatgacgacccaccggttcgac
ttcgcgcgtaccgccgaggccttcgatctggtggcggcctaccgcgacggggtggtcaag
gcgatgattcatttctga

DBGET integrated database retrieval system