KEGG   Kiritimatiella glycovorans: L21SP4_02072Help
Entry
L21SP4_02072      CDS       T04225                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vbl  Kiritimatiella glycovorans
Brite
Enzymes [BR:vbl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     L21SP4_02072 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKJ65305
UniProt: A0A0G3EKM0
LinkDB All DBs
Position
2428996..2429715
Genome map
AA seq 239 aa AA seqDB search
MKTAHSTHSSGTIHRRGFIGAAGATAALAAGGPAAAAAGAPYRQPPLPYSENALEPVITS
RTLSFHYGKHHRGYVNNVNELVKGTDWAGMPLDQLVVQTADNPEYAAVFNNAAQAWNHAF
YWNSMRPGGGGEPPAELKKMMQDVFGGVKACCKKLADAAGSQFGSGWAWLAVDGHGTLNV
LKTANADTPLARGMTPLLTIDVWEHAYYLDYQNRRGAYVAAVLDKLINWDFAMRNLERA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgcacattccacgcatagttccggcaccatccaccgacgcggcttcatcggc
gcggcgggcgccacggcggcgctggcggccggcgggcctgccgccgccgctgcgggagcg
ccgtacaggcagcctccccttccctactccgagaacgcgctcgaacccgtgatcacctca
cggaccctgagtttccactacggaaagcatcaccgcgggtacgtcaacaacgtaaacgag
ctggtcaaaggcaccgactgggccggaatgccgctggatcagctcgtcgtacagaccgcc
gacaacccggaatacgccgcggtgttcaacaacgcggctcaggcctggaaccacgccttc
tactggaacagcatgagacccggaggcggcggtgagccgcccgccgagctgaagaagatg
atgcaggatgtcttcggcggcgtgaaggcctgctgcaaaaagctcgcggacgcggccgga
tcgcagttcggcagcgggtgggcctggctggcggtcgacggccacggcacgcttaacgtg
ctcaagacggccaacgccgacaccccgctcgcccgcggcatgaccccgctgctgacgatc
gacgtgtgggaacacgcctactacctcgactaccagaaccggcgcggggcctacgtggcc
gccgtcctcgacaagctgatcaactgggacttcgccatgcggaatctcgagcgggcctga

DBGET integrated database retrieval system