KEGG   Variovorax boronicumulans: CKY39_01925Help
Entry
CKY39_01925       CDS       T05068                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
vbo  Variovorax boronicumulans
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKY39_01925
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CKY39_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAM72 ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ATA52118
UniProt: A0A250DCL0
LinkDB All DBs
Position
complement(417080..418225)
Genome map
AA seq 381 aa AA seqDB search
MSYQKLQPGATGAIGELAAMQAVVCHGPKDYRLETVAMPVIGANELLISIAACGICASDC
KCHSGAKMFWGGDGQPSWVKAPVIPGHEFFGYVEALGEGAAEHFGVEKGDRVIAEQIVPC
GKCRFCTSGKYWMCEVHHIFGFQRVVADGGMADYMRLPPTSRVHKIPDGISLEDAAIIEP
LACAIHTVNRGELQLDDVVVIAGAGPLGLMMTQVAALKTPKKLIVIDLVPERLALAKQYG
ADVVINPKTENADAIVKGLTEGYGCDVYIETTGAPIGVTQGLEMIRKLGRFVEFSVFGSE
TSADWSIIGDRKELDVRGAHLGPYCYPVAIDLLARGLVTSKGIVTHDFPLTEWEHAFALA
NSLDSIKVLLKPAPQASGSAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatcaaaagctccaacccggcgccacgggcgccatcggcgaactcgccgccatg
caggccgtcgtgtgccacggcccgaaggactaccggctcgaaaccgtcgcaatgcccgtc
atcggcgcgaacgaactgctcatctcgatcgcggcctgcggcatctgcgcctccgactgc
aagtgccactcgggcgcgaagatgttctggggcggcgacggccagccttcgtgggtcaag
gcgccggtcattcccggccacgagttcttcggctacgtcgaggcgctgggcgaaggcgcg
gcggaacacttcggcgtggagaaaggcgaccgcgtgatcgccgagcagatcgtgccctgc
ggcaagtgccgcttctgcacctcgggcaagtactggatgtgcgaggtgcaccacatcttc
ggcttccagcgcgtcgtggccgatggcggcatggccgactacatgcgcctgccgccgacc
tcgcgcgtgcacaagatccccgacggcatctcgctggaagacgcggccatcatcgagccg
ctggcctgcgcgatccacacggtgaaccgcggcgaactccagctcgacgacgtggtggtg
atcgccggcgccggcccgctgggactgatgatgacgcaggtggcagcactcaagacaccg
aagaagctcatcgtgatcgacctcgtgcccgagcgcctggcactcgcgaagcagtacggc
gccgacgtcgtcatcaacccgaagaccgaaaacgccgatgccatcgtcaagggcctcacc
gaaggctacggctgcgacgtgtacatcgagaccaccggcgcgcccatcggcgtgacgcag
gggttggagatgatccgcaagctcggccgcttcgtcgagttcagcgtgttcggttcggag
acgagcgccgactggtcgatcatcggcgaccgcaaggagctcgacgtgcgcggcgcgcac
ctgggcccgtattgctacccggtcgccatcgacctgctggcgcgcgggctcgtcacctcg
aagggcatcgtgacgcacgactttccgctgaccgaatgggagcacgccttcgcgctggcc
aactcgctcgactcgatcaaggtgctgctcaaacctgcaccgcaagcgtcgggcagcgcg
gcatga

DBGET integrated database retrieval system