KEGG   Variovorax boronicumulans: CKY39_12580Help
Entry
CKY39_12580       CDS       T05068                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vbo  Variovorax boronicumulans
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKY39_12580
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CKY39_12580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored Glutaredoxin HI0933_like FAD_binding_3 DAO Thi4 FMO-like K_oxygenase AlaDh_PNT_C Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ATA53961
UniProt: A0A1E7U4A0
LinkDB All DBs
Position
2746219..2747775
Genome map
AA seq 518 aa AA seqDB search
MLDASTKAQLKSYLERATQPIEIVASLDDSKASGEMLSLLKDVAEVSPLVTLTESRDDNH
RKPSFSVNRPSENHGPRFAGLPMGHEFTSLILALLQIGGYPPKVEQAVLDQIKALDGDFE
FEIYVSLTCHNCPDVVQALNLMAIQNPRIRTTMIEGGTFQDEVKERQIMAVPTVFLNGTE
FGQGRMSLEEILAKIDTSGVEREAAKIAAKDAFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTLGIENFISIKETEGPKFAHALEEHVRDYDVDIMNLQRAKALVPGKDLI
EVQLESGASLKSKTVIISTGARWRNINVPGEHEFKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLIEFDTQLRADAVLQRKLKSLKNVDIFTNAQTTEITGDQKV
NGLVYKDRASGELKKVELEGVFIQIGLVPNTDWLKGTVELTKHGEIVVDARGQTSVPGVF
AAGDVTTVPFKQIIIAAGDGAKAALGAFDHLIRTTAPA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgccagcaccaaagcccaattgaagagttacctcgaacgcgccacgcagccg
atcgagatcgttgcctcgctcgacgacagcaaggcttcgggcgaaatgctgtcgctgctg
aaggacgttgccgaagtctcgccgctggtcacgctgaccgaaagccgcgacgacaaccac
cgcaagccctcgttctcggtcaatcgcccgagcgaaaaccacggcccgcgctttgccggc
ctgccgatgggccatgaattcacgtcgctgatccttgcgctgctgcagatcggcggctac
cccccgaaggtcgagcaggccgtgctcgaccagatcaaggcgctcgacggcgacttcgag
ttcgagatctacgtctcgctcacctgccacaactgccccgacgtggtccaggcgctgaac
ctgatggccatccagaacccgcgcatccgcaccacgatgatcgagggcggcaccttccag
gacgaagtgaaggaacgccagatcatggccgtgccgaccgtgttcctgaacggtaccgag
ttcggccagggccgcatgagcctggaggaaatcctcgccaagatcgacaccagcggcgtg
gagcgcgaagccgccaagatcgccgccaaggacgcgttcgacgtgctgatcgtcggcggt
ggccccgccggtgccgctgccgcggtgtacgccgcacgcaagggcatccgcacgggtgtc
gcctcggagcgcttcggcggccaggtgctcgacacgctgggcatcgagaacttcatctcg
atcaaggaaaccgaaggaccgaagttcgcccacgccctcgaagagcacgtgcgcgactac
gacgtcgacatcatgaacctgcagcgcgccaaggcactggtgccgggcaaggacctaatc
gaggtgcagctcgaaagcggcgcgtcgctcaagagcaagaccgtcatcatttcgaccggt
gcccgctggcgcaacatcaacgtgccgggcgagcacgagttcaagaacaagggcgtggcc
tactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcggtgatcggcggc
ggcaactcgggtgttgaagctgcgatcgacctggccggcatcgtcggccacgtcacgctg
atcgaattcgacacgcaactgcgcgccgacgccgtgctgcagcgcaagctcaagagcctg
aagaacgtcgacatcttcaccaacgcgcagaccaccgagatcaccggcgaccagaaggtc
aacgggctggtctacaaggaccgcgcatcgggcgagctgaagaaggtcgaactcgaaggc
gtgttcatccagatcggcctggtgcccaacaccgactggctcaagggcacggtcgagctg
acgaagcacggcgagattgttgtcgacgcgcgcggccagacctcggtgcccggcgtgttc
gcggcgggtgacgtcaccacggtgccgttcaagcagatcatcatcgcggccggcgacggc
gcgaaggcggcgctcggtgcgttcgaccacctgatccgcacgacggcccctgcgtga

DBGET integrated database retrieval system