KEGG   Variovorax boronicumulans: CKY39_14175Help
Entry
CKY39_14175       CDS       T05068                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00010  Glycolysis / Gluconeogenesis
vbo00620  Pyruvate metabolism
vbo01100  Metabolic pathways
vbo01110  Biosynthesis of secondary metabolites
vbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKY39_14175
   00620 Pyruvate metabolism
    CKY39_14175
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CKY39_14175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATA54240
UniProt: A0A250DIS1
LinkDB All DBs
Position
3082144..3083664
Genome map
AA seq 506 aa AA seqDB search
MDMLEPGKFGTAVPFKKRYGNYIGGEWVAPVENQYFGNITPVTGKVFCEVPRSSAADIER
TLDAAHKAKGAWGRTSTTERANILNRIADRMQENLAMLAAAETWDNGKPIRETMAADLPL
AIDHFRYFASCVRSQEGGISEIDHETFAYHFHEPIGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPVSILVLMEVIGDLLPPGVLNIVNGFGVEAGKPLASSNRIGKIAFTG
ETTTGRLISQYASQNLIPVTLELGGKSPNIFFADVMERDDAFFDKALEGFTMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIKQGSPLDAATMIGAQASSEQLEKILSYLDIGR
QEGAQVLIGGERQQLDGDLADGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
SIANDTLYGLGAGVWSRDMNRAFRMGRGIQAGRVWTNCYHQYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSENKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatgctcgaaccgggcaaattcggtaccgcggtgcctttcaagaagcgctacggc
aactacatcggcggcgaatgggtcgcgccggtggagaaccagtatttcggcaacatcacg
cccgtcaccggcaaggtcttctgcgaagtgccgcgctccagcgccgccgacatcgagcgc
acgctcgacgccgcgcacaaggccaagggcgcctggggccgcacctcgaccaccgagcgc
gccaacatcctgaaccgcatcgccgaccgcatgcaggaaaacctggccatgctggcggcg
gccgagacctgggacaacggcaagccgatccgcgagaccatggccgccgacctgccgctg
gccatcgaccacttccgctacttcgcctcgtgcgtgcgctcgcaggagggcggcatcagc
gagatcgaccacgagaccttcgcgtaccactttcatgaacccatcggtgtggtcggccag
atcattccgtggaacttcccgatcctcatggccgtgtggaagctcgcacccgcgctggcg
gccggcaactgcgtggtgctcaagcccgccgagcagacgccggtgtcgatcctggtgctg
atggaggtcatcggcgacctgctgccgccgggcgtgctgaacatcgtcaacggcttcggc
gtggaggcgggcaagccgctggcgtcgagcaaccgcatcggcaagatcgccttcaccggc
gagaccaccacgggccggctgatctcgcagtacgcgagccagaacctcattccggtcacg
ctggagctgggcggaaagtcgcccaacatcttctttgccgacgtgatggagcgcgacgac
gccttcttcgacaaggcgctcgaaggcttcacgatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgagccgggcgctgatccaggaatcgatctacgaccgcttcatggagcgt
gcattgaaacgcgtggccgcgatcaagcagggcagcccgctcgacgcggccaccatgatc
ggcgcgcaggcctcgagcgagcagctggaaaagatcctgtcgtacctggacatcggccgg
caggagggcgcgcaggtgctcatcggcggcgaacgccagcaactcgacggcgatctggcc
gacggctactacgtcaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggaaatcttcggaccggtcgtgtcggtcaccaccttcaaggacgaggaagaagcgctg
tccatcgccaacgacacgctctacggcctgggcgccggcgtgtggagccgcgacatgaac
cgggccttccgcatgggccgcggcatccaggcggggcgcgtgtggaccaactgctaccac
cagtacccggcgcatgcggccttcggcggctacaagcagtcgggcatcgggcgggagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctcgtgagctacagcgag
aacaagctgggcttcttctga

DBGET integrated database retrieval system