KEGG   Variovorax boronicumulans: CKY39_27880Help
Entry
CKY39_27880       CDS       T05068                                 

Gene name
dppD
Definition
(GenBank) dipeptide ABC transporter ATP-binding protein DppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
vbo  Variovorax boronicumulans
Pathway
vbo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CKY39_27880 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbo02000]
    CKY39_27880 (dppD)
Transporters [BR:vbo02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CKY39_27880 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_7 Mg_chelatase AAA_16 AAA_29 CbiA RsgA_GTPase ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: ATA56628
UniProt: A0A250DQK4
LinkDB All DBs
Position
6021622..6022659
Genome map
AA seq 345 aa AA seqDB search
MNTANTTPRLTVTNLSTSFPTEDGLIRSVADVSFSIQPGKTTALVGESGSGKSVTSLTLM
RLLPKTANAQVSGSASFVTREGKTLDLLQIGEREMRSLRGNQLSMIFQEPMTSLNPVFTI
GEQIAESVRLHKGLDRKAALAHALRMLELVEIPAAAQRIHEYPHQLSGGMRQRVMIALAM
ACDPTLLIADEPTTALDVTIQAQILELMRRLQAETGMSILFITHNLGVVAHHADDVVVMY
SGRVVERAPVRPLFAQPEHPYTQGLLACLPGKARVPGQPKPKRLFAIRGQVSSPLAPPPG
CAFEPRCDQALPECRSAMPPLIDIRQDRQARCVRVQPDQPLARAA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgcgaacaccaccccacgcctcacggtcaccaacctgagcaccagctttccc
accgaggacggattgatccgctcggtggccgatgtgagcttctcgattcagcccggcaag
accaccgcactggtgggcgaatcgggctcgggcaagtcggtcaccagcctcacgctgatg
cgcctcttgcccaagaccgccaacgcacaggtcagcggatcggcttccttcgtcacccgc
gaaggcaagacgctggacctgctgcagatcggcgagcgcgagatgcgctcgctgcgcggc
aaccagctgtcgatgatcttccaggagccgatgaccagcctgaacccggtgttcaccatc
ggcgagcagatcgccgagagcgtgcgcctgcacaaggggctcgatcgcaaggccgcgctg
gcccatgcactgcgcatgctggagctggtcgagattccggctgccgcgcaacgcatccac
gagtacccgcaccagctctcgggcggcatgcgccagcgcgtgatgatcgcgctggccatg
gcctgcgacccgacgctgctgatcgccgacgagcccaccaccgcgctggacgtgaccatc
caggcgcagatcctcgaactcatgcgtcggctgcaggccgagacgggcatgagcatcctg
ttcatcacgcacaacctgggcgtggtggcgcaccatgccgacgacgtggtggtcatgtac
tcgggccgcgtggtcgagcgtgcaccggtgcgcccgctcttcgcgcagcccgagcacccg
tacacgcaaggcctgctggcctgcctgccgggcaaggcgcgggttcctgggcaacccaag
cccaagcggctgttcgcgattcgtgggcaggtgtccagcccgctggcgccgccacccggc
tgtgccttcgagccgcgctgcgaccaggcactgcccgaatgccgcagcgccatgccgccg
ctcatcgacatccgtcaggaccgccaggcgcgttgtgtgcgcgtgcagcccgaccaaccg
ctcgcgagggctgcatga

DBGET integrated database retrieval system