KEGG   Variovorax boronicumulans: CKY39_28350Help
Entry
CKY39_28350       CDS       T05068                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CKY39_28350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbo02000]
    CKY39_28350
Enzymes [BR:vbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CKY39_28350
Transporters [BR:vbo02000]
 Other Transporters
  Pores ion channels [TC:1]
   CKY39_28350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ATA56703
UniProt: A0A1E7TZ51
LinkDB All DBs
Position
complement(6131741..6132415)
Genome map
AA seq 224 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELELPYEIVHYQRDPKTMLAPASLKAVHPLGKSPVVTTDD
GATLAESGAIIESLIERYGQGRLAPAPGSPEALRYRYWLHFAEGTAMSPLLLKLVFDRIE
TSKMPFFAKPIAKAIAAKAKSAFIHPNITGHLNFMEAELGRSEWFAGNEFTGADIQMSFV
VEASQARGGLDARRPKLMAYLERIHARPAYKRALERGGPYELLS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctcactgtccatcacctgaacaactcgcgctcgcaacgtgtgctctggctgctcgaa
gaactcgagctgccctacgagatcgtccactaccagcgcgaccccaagaccatgttggcg
cccgcttcgctgaaagccgtgcatccgctgggcaagtcgcccgtggtgacgaccgacgac
ggcgcgacgctggcggaatcgggcgcgatcattgagtcgctcatcgaacgctacggccag
ggccggctcgcgcccgcgccgggttcgcccgaagccttgcgctaccgctactggctgcac
ttcgccgaaggcacggcgatgtcgccgctgctgctcaagctggtgttcgaccgcatcgag
acgagcaagatgcccttctttgccaagccgatcgccaaggccatcgcggcgaaggcgaag
tcggccttcattcatccgaacatcacgggccatctgaatttcatggaggccgaactcggc
cgcagtgagtggttcgcgggcaatgagttcacgggcgccgatatccagatgagtttcgtg
gtcgaagcctcgcaggcgcgcggcgggctcgatgcgcggcggcccaagctcatggcctac
ctggagcgcatccatgcgcgcccggcctacaagcgcgcgctggaacgcggtggcccctac
gaactgctgagctga

DBGET integrated database retrieval system