KEGG   Variovorax boronicumulans: CKY39_28490
Entry
CKY39_28490       CDS       T05068                                 

Gene name
dmpH
Definition
(GenBank) 2-oxo-3-hexenedioate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00362  Benzoate degradation
vbo00621  Dioxin degradation
vbo00622  Xylene degradation
vbo01100  Metabolic pathways
vbo01120  Microbial metabolism in diverse environments
vbo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKY39_28490 (dmpH)
   00622 Xylene degradation
    CKY39_28490 (dmpH)
   00621 Dioxin degradation
    CKY39_28490 (dmpH)
Enzymes [BR:vbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     CKY39_28490 (dmpH)
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: ATA56724
UniProt: A0A250DR08
LinkDB
Position
complement(6176792..6177580)
AA seq 262 aa
MKLDKNTIAALAEHLETCELEARDTPKITDEHPEMDWDDAYAIQNEIRRRKLARGHRIIG
LKAGLTSHAKMKQMGVTTPVFGFMADNYALPEGGECKVSELIHPKVEPEIAFVTKRALSG
PGCHIGAVLAATDFVLPGIEVIDSRYRDFKFDLKSVVADNTSASRFVVGGRAVPASEVDL
RTVGIVLEKNGQPVAFGAGAAVLGHPAAAIAMLANHLGARGEEIPAGTLILSGGITEAVA
VQAGDAVTLKVQGMGSVGLRFV
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaagctcgacaagaacaccatcgccgcgctcgccgagcacctggagacctgcgagctc
gaggcgcgcgacacgcccaagatcaccgacgagcatcccgagatggactgggacgatgcc
tacgccatccagaacgagatccgccgccgcaagctcgcgcgcggccaccgcatcatcggg
ctgaaggccgggctcacctcgcacgccaagatgaagcagatgggcgtgaccacgccggtc
ttcggcttcatggccgacaactacgcgctgcccgaaggcggcgaatgcaaggtgagcgag
ctcatccatccgaaggtcgagcccgagatcgcgttcgtcaccaagcgcgcgctcagcggc
ccgggctgccacatcggcgccgtgctcgcggccaccgacttcgtgctgccgggcatcgag
gtgatcgacagccgctaccgcgacttcaagttcgacctgaagagcgtggtggccgacaac
acctcggcctcgcgcttcgtggtgggcgggcgcgccgtgcccgcgagcgaggtcgacctg
cgcaccgtcggcatcgtgctggagaagaacggccagcccgtggccttcggcgcgggcgcc
gccgtgctcggccacccggccgcggcgattgcgatgctggccaaccacctgggcgcgcgc
ggcgaggagattccggcgggcacgctgattctttcgggcggcatcaccgaggccgtggcc
gtgcaggccggcgatgccgtcacgctgaaggtgcagggcatgggcagcgtgggcctgcgc
ttcgtctga

DBGET integrated database retrieval system