KEGG   Variovorax boronicumulans: CKY39_28800Help
Entry
CKY39_28800       CDS       T05068                                 

Definition
(GenBank) hypothetical protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00071  Fatty acid degradation
vbo00280  Valine, leucine and isoleucine degradation
vbo00281  Geraniol degradation
vbo00310  Lysine degradation
vbo00362  Benzoate degradation
vbo00380  Tryptophan metabolism
vbo00410  beta-Alanine metabolism
vbo00640  Propanoate metabolism
vbo00650  Butanoate metabolism
vbo00903  Limonene and pinene degradation
vbo00930  Caprolactam degradation
vbo01100  Metabolic pathways
vbo01110  Biosynthesis of secondary metabolites
vbo01120  Microbial metabolism in diverse environments
vbo01130  Biosynthesis of antibiotics
vbo01200  Carbon metabolism
vbo01212  Fatty acid metabolism
Module
vbo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CKY39_28800
   00650 Butanoate metabolism
    CKY39_28800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CKY39_28800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKY39_28800
   00310 Lysine degradation
    CKY39_28800
   00380 Tryptophan metabolism
    CKY39_28800
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKY39_28800
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CKY39_28800
   00281 Geraniol degradation
    CKY39_28800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKY39_28800
   00930 Caprolactam degradation
    CKY39_28800
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CKY39_28800
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CKY39_28800
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CKY39_28800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 3HCDH
Motif
Other DBs
NCBI-ProteinID: ATA56772
UniProt: A0A250DRA2
LinkDB All DBs
Position
complement(6238995..6240407)
Genome map
AA seq 470 aa AA seqDB search
MHSNIRFEVDADGVALLTLDVPDRPMNVFTPGFTADLRAAVAQIAQRADVRGAVITSGKA
SGFMAGADLKDLVGFHATGGSAADAAEAIAPGGRVLRELERCGKPVAVAINGVALGGGFE
LALACHYRVLLDEPRAVVGLPEVTVGLLPVGGGTQRLPRLVGIARALPLLLSGQHVAPAE
ALALGMVDALAPADQLVAVARRWVLDHPDAGQQPWDVKGFQVPGGAGALAPHAGASFGAT
LAQVRRDTHDQLPAPLAILSAVYEGTQLPMDAGLAVEAQCFGPLLAGPVARNLMRTLFVN
RGAALRRKGDLSTVNAAYVERLRQLYRSEGAALLSEGVSPALIANAARQAGLGESPLAAD
APATQATTSQPDARAVGERLLSLLALEAARCLEEGVLKQPVEADLGAVLALGYPDWTGGT
LSYIETVGLAAFVARCDALAQRHGERFKPTAALRQRAQSNTLFYPVEHAA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcattccaacatccgattcgaggtcgatgccgacggcgtcgcgctcctcaccctcgac
gtgcccgaccggccgatgaacgtgttcacgcccggcttcacggccgacctgcgcgcggcc
gtggcgcagatcgcgcagcgcgccgacgtgcgcggtgcggtcatcacctcgggcaaggcc
agcggcttcatggccggggccgatctcaaggacctcgtgggctttcatgcgacaggtggc
agcgcggccgatgccgccgaggccatcgcgcccggcggtcgcgtgctgcgcgagctggag
cgctgcggcaagcccgtggcggtggcgatcaacggcgtggcgctgggcggcggtttcgaa
ctcgcgctggcctgccattaccgcgtgctgctcgacgaaccgcgcgcggtggtcggtctg
cccgaggtcacggtcggcctgctgccggtgggcggcggcacgcagcggctgccgcgcctc
gtcggcattgcgcgcgcgctgccgctgctgctgtcgggccagcacgtggcgccggccgag
gcgctggcgctgggcatggtcgatgcgctcgcgccggccgaccagctcgtggccgtggcc
cgtcgctgggtgctcgaccaccccgacgccggccagcagccgtgggacgtgaagggtttt
caggtgcccggtggcgcgggcgcgctcgcaccgcacgcgggcgcgagcttcggcgccacg
ttggcgcaggtgcggcgcgacacgcacgaccagctgcccgcgccgctggccatcctgtcg
gcggtgtacgaaggcacgcagctgccgatggacgcgggcctggcggtcgaggcgcagtgc
ttcggtcccttgctggccggcccggtggcgcgcaacctgatgcgcacgctgttcgtgaac
cggggcgcggcgctgcggcgcaagggcgacttgagtacggtcaatgctgcgtatgtcgaa
cggctgcggcagctgtaccgaagtgaaggcgcggcgctgttgtcggaaggcgtgtcgcct
gcattgattgcgaacgccgcgcggcaggccgggttgggagagagtccgctggctgccgat
gctcccgcgacacaggccaccacatcgcagcccgacgcacgcgccgtcggcgaacgcctg
ctgtcgctgctcgcgctcgaagccgcacgttgcctcgaagaaggcgtgctgaagcagccg
gtcgaagccgacctcggcgcggtgcttgcattgggctatcccgactggaccggcggcacg
ctctcgtacatcgagaccgtcggcctcgcggccttcgtcgcgcgctgcgatgcactcgcg
cagcgccacggcgagcgcttcaagcccacggctgcgttgcgccaacgcgcgcaatcgaac
acgctgttctatcccgtggagcacgccgcgtga

DBGET integrated database retrieval system