KEGG   Variovorax boronicumulans: CKY39_32205Help
Entry
CKY39_32205       CDS       T05068                                 

Definition
(GenBank) hydroxypyruvate isomerase
  KO
K22131  2-dehydrotetronate isomerase [EC:5.3.1.35]
Organism
vbo  Variovorax boronicumulans
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKY39_32205
Enzymes [BR:vbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.35  2-dehydrotetronate isomerase
     CKY39_32205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF4840
Motif
Other DBs
NCBI-ProteinID: ATA57372
UniProt: A0A250DSZ9
LinkDB All DBs
Position
complement(6955659..6956477)
Genome map
AA seq 272 aa AA seqDB search
MPQFAANLSMLYPELAFLDRFDAAAKDGFQAVEYLFPYDFSKEEIVARLKHNGLQQVLFN
GPPGDWAGGERGLACLPGREGEFREGIAKAIDYAVALDCPRIHVMAGLVPEGLTREAAEA
VYVGNLRWAAAEAAKAGRDVLIEPINTRDIPRFFLNRQDHAHQIVETVGAANLKVQMDLY
HCQIVEGDVAMKLRQYLPTGRVGHLQIAGVPERHEPDVGEQNYDYLFGVIDEVSAQCGWQ
GWVGCEYRPRRGMEPGGTSAGLGWLRDWRQRA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccccaattcgccgccaacctctcgatgctctacccggagctcgcatttctcgaccgc
ttcgacgccgccgcgaaagacggcttccaggccgtcgagtacctctttccctacgacttc
agcaaggaagagatcgtcgcgcgcctgaagcacaacggcctgcagcaggtgctgttcaac
ggcccgcccggcgactgggccggcggcgagcgcggcctggcctgcctgccggggcgcgag
ggcgagttccgcgaaggcattgccaaggccatcgactacgccgtggcgctcgactgcccg
cgcatccacgtcatggccggcctcgtgcccgaaggcctcacgcgcgaggcggcagaggcc
gtctatgtcgggaacctgcgctgggccgcggccgaggccgcgaaggcggggcgcgacgtg
ctcatcgagccgatcaacacgcgcgacattccgcgcttcttcctcaaccggcaggaccac
gcgcaccagatcgtcgagaccgtgggcgccgccaacctcaaggtgcagatggacctgtac
cactgccagatcgtcgaaggcgacgtggcgatgaagctgcgccagtacctgccgaccggc
cgcgtcggccacctgcagatcgcgggcgtgcccgagcgccacgagcccgatgtgggcgag
cagaactacgactacctcttcggcgtgatcgacgaggtttcggcgcagtgcggctggcaa
ggctgggtcggttgcgagtaccgcccgcgccgcggcatggagcccggcggcacctcggcc
ggcctgggctggctgcgcgactggcgccagcgcgcatga

DBGET integrated database retrieval system