KEGG   Vibrio breoganii: A6E01_01015Help
Entry
A6E01_01015       CDS       T04649                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vbr  Vibrio breoganii
Pathway
vbr00620  Pyruvate metabolism
vbr00680  Methane metabolism
vbr01100  Metabolic pathways
vbr01120  Microbial metabolism in diverse environments
vbr01200  Carbon metabolism
Module
vbr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6E01_01015
  09102 Energy metabolism
   00680 Methane metabolism
    A6E01_01015
Enzymes [BR:vbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A6E01_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANO31868
UniProt: A0A193K931
LinkDB All DBs
Position
1:complement(208947..211577)
Genome map
AA seq 876 aa AA seqDB search
MNKKYSALTSNVKMLGNLLGRTIKDAHGEDILNKVETLRKLSKSARSGNQEDRQALINEI
ENLPDDQFIPVARAFNQFLNLTNIADQYHTISRHCEEQVCEPDVIQTLFSKLNSQDISKA
EASEAINNLNIELVLTAHPTEVTRRTMINKLLKINDCLSKLELSDIGHSERVKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAIPDFLRELDDRVSTHLDERLPIDA
RPVHFSSWMGGDRDGNPFVTHNITQEVLWLSRWKAADLYHADIEELITELSMTKCNETVR
ELAGDSHEPYRAILKELRTLLSNTQQVIDAKVLGSTVPNLPILESADQLWNPLHTIYTSL
HECGMGVIAEGSLLDTLRRIKCFGVHLVRLDIRQESTRHSDALSEVTRFLGLGDYDQWSE
QDKVAFLVKELSSNRPLIPHNWEPSAEVKEVIDTCKTIAEHPIEAFGAYVISMARTASDV
LAVHLLLREAGCKFRLGVCPLFETLDDLNNSEAVMQQLFNIDWYRGFIQGEQMVMIGYSD
SAKDAGVMSAGWAQYDAMDKLVKVCDAQNIDLTLFHGRGGTIGRGGAPAHAALLSQPPKS
LQGGLRVTEQGEMIRFKLGLPQVAVNSLNLYASAILEANLLPPPEPKKDWRDLMEVLSQV
SCEAYRGVVRGEPDFVPYFRAATPELELGKLPLGSRPSKRNPNGGVESLRAIPWIFSWSQ
NRLVLPAWLGAGEAIQYSIDEGHLELLEEMCREWPFFSTRLGMLEMVYYKCSMDISKLYD
EKLTDPSLWRLGESLRTQLQKDIQAVLKVENNENLMQSDPWGLESIRLRNIYVDPLNMLQ
VELLKRTRKTEENNPDLEEALMITIAGIAAGMRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaatattctgcactcacaagtaacgttaagatgcttggcaatctacttggc
agaaccatcaaagatgcccacggagaggacattctcaacaaagttgagacccttcgtaaa
ctgtccaaatcagctcgcagtggcaaccaagaagatcgacaagccctaatcaatgagatt
gaaaatctgccggatgatcaattcattcctgtagcgcgcgcgttcaaccaatttttgaat
ctgactaacatcgccgatcagtaccacactatttctcgtcattgcgaagagcaggtttgt
gaacccgatgtcattcaaactcttttcagcaagctaaattctcaagacatctcaaaagct
gaagcgtcagaggccatcaacaacctcaacatcgaattggtattgactgctcacccgact
gaagtgacgcgtcgtactatgatcaacaagcttctaaagatcaatgactgtttatctaag
ctagagctaagcgatatcggtcactctgagcgtgttaaaacagagcgtcgcctagagcag
cttattgcacaaagttggcactctgacgttattcgccagcaacgcccgacacctcttgat
gaagctaaatggggctttgcggtagtagaaaattctctttgggaagccattcccgacttc
ttacgtgagttggacgaccgtgtctcaacacatctcgatgagcgcctacctattgatgct
cgtcctgtgcacttttcatcatggatgggtggtgaccgagacggtaacccatttgtgact
cacaacatcactcaagaagtattgtggttatctcgctggaaggcggctgacctttatcat
gcagacattgaggagctgatcactgagctttcaatgactaagtgtaatgaaactgtacgt
gagcttgccggtgacagccatgaaccgtaccgtgcgatccttaaagagcttcgtacactt
ctaagcaacactcaacaagttatcgacgctaaggtgttaggctctacggttcctaatctg
ccaatccttgaaagtgccgatcagctttggaacccgctacacaccatctacacctctttg
catgagtgtggcatgggtgtcattgcagaaggttcactgcttgataccctgcgacgcatc
aagtgtttcggcgttcatctcgttcgtttggatattcgtcaagaaagcacgcgccactca
gatgcactctctgaagtgactcgcttccttggtctgggtgactacgaccaatggagtgaa
caagacaaggttgcattcttagttaaagagctaagctcgaaccgccctcttatcccgcac
aactgggaaccttctgctgaagttaaagaggtaattgacacctgtaagaccattgctgag
cacccaattgaagcctttggcgcgtacgttatctcaatggcgcgcacagcctcagatgta
ttagcggttcatctactgcttcgcgaagcaggctgtaaattccgcctaggggtttgtcct
ttgtttgaaacactggatgacttgaacaactctgaagcggttatgcagcaactgttcaat
atcgactggtaccgtggatttatccaaggcgagcagatggtcatgatcggttactctgat
tcagcgaaagatgcgggcgttatgtcggctggctgggctcagtatgacgcgatggacaaa
ctggttaaggtgtgtgacgcacagaacattgacctgactctattccacggtcgtggcggt
actatcggtcgtggtggcgctccagcgcacgctgcactgctttctcagccaccaaaaagc
ctccaaggcggccttcgtgtaacagaacaaggtgagatgattcgctttaagctgggtctt
cctcaagtcgcggtgaacagcctgaacttatacgccagtgcgattcttgaagcgaacctg
cttccaccaccagagccaaagaaagattggcgtgatctgatggaagtgctgtcgcaggtg
tcttgtgaggcctatcgtggcgttgttcgtggcgaacctgactttgtcccttacttccgc
gcagctacaccagaacttgaactaggcaaactgcctcttggttctcgtccttcaaagcgt
aaccctaatggtggcgttgagagcttacgtgctatcccatggatcttctcatggagccaa
aaccgtctggtacttccagcgtggttaggtgccggtgaagccattcagtactctatcgat
gagggccatcttgagctactagaagagatgtgtcgcgagtggccattcttctctacacgc
ttaggcatgctagagatggtgtactacaagtgcagcatggatatctcaaagctgtacgat
gagaaactgacagacccttctctatggcgcctaggtgagagcctacgtacacaactgcaa
aaagacatccaagcggtgctgaaggttgagaacaacgagaacctgatgcaaagcgaccca
tggggccttgagtcaattcgtctacgtaacatctacgtagatccattgaacatgcttcaa
gtggagcttcttaaacgcacaaggaaaacggaagaaaataatcctgacctagaagaagcg
cttatgatcacaattgcaggtattgctgctggcatgcgcaacacaggctaa

DBGET integrated database retrieval system