KEGG   Vibrio breoganii: A6E01_03720Help
Entry
A6E01_03720       CDS       T04649                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vbr  Vibrio breoganii
Pathway
vbr00220  Arginine biosynthesis
vbr00250  Alanine, aspartate and glutamate metabolism
vbr00290  Valine, leucine and isoleucine biosynthesis
vbr01100  Metabolic pathways
vbr01110  Biosynthesis of secondary metabolites
vbr01130  Biosynthesis of antibiotics
vbr01210  2-Oxocarboxylic acid metabolism
vbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A6E01_03720
   00290 Valine, leucine and isoleucine biosynthesis
    A6E01_03720
   00220 Arginine biosynthesis
    A6E01_03720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vbr01007]
    A6E01_03720
Enzymes [BR:vbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     A6E01_03720
    2.6.1.66  valine---pyruvate transaminase
     A6E01_03720
Amino acid related enzymes [BR:vbr01007]
 Aminotransferase (transaminase)
  Class I
   A6E01_03720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANO32361
UniProt: A0A193KAD8
LinkDB All DBs
Position
1:complement(784458..785672)
Genome map
AA seq 404 aa AA seqDB search
MKNIEMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDTPDEILVDVLR
NLPTSQGYCDSKGIYSARKAVVQYYQRKGLRSLDVEDVYMGNGVSELIVMAMQALLNNGD
ELLVPAPDYPLWSAAVSLSGGNPVHYLCDEQSDWFPDIEDIKSKITPKTRGLVLINPNNP
TGAVYSRDLLLQIIEVAREHNLIIFADEIYDKILYDGATHTSIATLADDVVMVTFNGLSK
AYRICGFRSGWMFITGPKHLAKGYIDGLDMLSSMRLCANVPMQHAVQTALGGYQSINELI
LPGGRLLEQRDRAFDMITSIPGVSCVKPKGALYLFPKLDPKIYKIHDDQKMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHIEDLEVAIGRFERFITQYTQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcgagatgtcatcaaaactcgataatgtatgctacgacattcgtggtccc
gtactcaaacatgctaaacgcatggaagaagaagggcataaaattcttaaactaaatatc
ggcaaccccgccccgtttggttttgatacccctgatgaaattctagtcgatgtactgaga
aatctaccaacctctcagggttactgtgactctaaaggtatttactctgctcgtaaggct
gtggttcagtattatcaaagaaaagggctacgttcattagacgttgaagacgtttacatg
ggtaacggtgtttccgagttgatcgtaatggcgatgcaagccctactgaataatggcgac
gaattactggtacctgcgcctgattaccctttgtggtcggcagcagtatctctatctggg
ggtaacccagttcattacctatgtgatgagcaatctgattggttccctgatatcgaagat
atcaagtctaagatcacacccaagacgcgtggtctggttctgatcaaccctaataaccca
accggagcggtctacagtcgcgatctattgttgcaaattattgaggtcgctcgcgagcac
aaccttattatctttgccgacgaaatctacgacaaaatcctttacgacggtgccactcac
acctctattgccactctggcagacgacgtggtgatggttaccttcaatggtctatcaaag
gcctaccgtatttgtggcttccgcagtggttggatgttcatcaccggtcccaagcacctt
gcaaaaggctatattgatggcttagacatgctttcgtctatgagactgtgtgccaacgta
cctatgcaacatgccgtgcaaaccgcattagggggttaccaaagtatcaacgagttgata
ctgccgggtggtcgacttttagagcaacgagacagagcgtttgacatgatcacttctatt
cccggtgtatcgtgtgtcaaacccaaaggtgcactgtacctgttccctaaattagatccc
aagatctacaaaatccatgatgatcaaaaaatggtgctagactttttgaaacaagagaag
gtgctattggttcagggttcaggatttaactggcctaagcccgaccactttaggattgtc
accttgccacatatcgaagacctcgaagtggcgataggacgcttcgagcgtttcatcacg
cagtacacacaataa

DBGET integrated database retrieval system