KEGG   Verrucomicrobia bacterium S94: EGM51_14750Help
Entry
EGM51_14750       CDS       T05990                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
vbs  Verrucomicrobia bacterium S94
Pathway
vbs00790  Folate biosynthesis
vbs01100  Metabolic pathways
Module
vbs_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vbs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EGM51_14750 (folP)
Enzymes [BR:vbs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EGM51_14750 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: QBG49322
UniProt: A0A4P6PIP1
LinkDB All DBs
Position
complement(3349422..3350207)
Genome map
AA seq 261 aa AA seqDB search
MGILNVTPDSFSDGGTFMDPEIAVEHALQMIAEGADLIDIGGESTRPGAQPVTVEEEIRR
TVPVIEKLRAKTDVLISIDTMKSKTAFQALEAGADIINDVSGFEFDEKMADVAAGSGAGV
VLMHMKGTPQTMQTNPDYEDPVREVFHYLEKRIAFAVDRGVKRKNIVIDPGIGFGKTLEH
NLQLLRRIPDFAATAPVMIGASRKSMIGKILEREDPNQRLAGSLGVAGWSAAFGAHILRV
HDVLDTCDVCRIVDTLCNGDL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggtattctgaatgtcaccccggattctttttccgatggagggacttttatggatccc
gaaatagcggttgaacacgcgctgcagatgattgctgaaggtgcggaccttattgacatc
ggcggggaatctacacggcccggcgcgcagcccgttactgtggaagaagaaatccggcgt
acggttccggtgattgaaaaactgcgcgcaaaaaccgatgtcctgatttcgatcgatacc
atgaaatcgaaaaccgctttccaggctctggaagccggcgcggatattattaatgatgtt
tccggatttgaatttgatgaaaagatggcggatgttgcggccggatcgggtgcaggggtt
gttctgatgcatatgaaaggtacccctcagacgatgcagaccaatccggattatgaagat
cccgtacgcgaggtgttccactatctggaaaagcggatcgcttttgccgttgatcgtggt
gttaaacggaaaaacatcgtgattgatcccgggatcggattcggcaaaacactcgagcac
aaccttcaattactgcgccgtattcccgactttgcagcaacagcaccggttatgatcggg
gcatcacgtaaaagcatgatcggaaaaattctggagcgggaagatccgaatcagcgtctg
gcaggaagcctgggtgttgccggatggtcggcggcgttcggtgcgcatattttgcgggtg
cacgacgtattagacacttgcgatgtatgtcgtatcgtggatacactttgcaacggtgac
ttataa

DBGET integrated database retrieval system