KEGG   Vibrio campbellii: M892_19470Help
Entry
M892_19470        CDS       T02837                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vca  Vibrio campbellii
Brite
Enzymes [BR:vca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M892_19470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGU98288
UniProt: A7N4I4
LinkDB All DBs
Position
II:353309..353821
Genome map
AA seq 170 aa AA seqDB search
MKLSALMAACVLLSGSALADELTVEMTDLATGKSVGEVAITTSDYGTVFTPNLSGLPSGA
HGFHIHANGSCDSRIKDGKTVLGGAAGGHYDPKGTGQHGFPWTDGNHLGDLPAMYVDANG
MANQPVLAPRVKLADVKGRALMVHFGGDNHSDHPAKLGGGGARMVCGVIK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagtgctttaatggcggcttgcgttttgctatcaggttcggctcttgccgat
gagttaacggtggaaatgaccgatcttgcaacaggtaagtctgttggcgaagttgcgatt
acaactagcgattatggtacggttttcactccaaacttaagcggtcttccatctggtgct
catggtttccatatccacgctaatggctcttgtgatagcagaattaaagatggaaaaaca
gtgttaggtggtgctgctggtggtcactatgaccctaaaggtactggtcagcatggattt
ccttggactgatggcaaccacttaggtgatctacctgcaatgtacgtagatgcaaacggc
atggcgaatcaacctgtgcttgcaccacgagttaagctagcggatgtaaaaggtcgagcg
cttatggttcactttggcggtgacaaccactcagatcatccagcgaaacttggcggtggt
ggtgcgcgcatggtttgtggcgtaattaagtaa

DBGET integrated database retrieval system