KEGG   Vibrio cyclitrophicus: FAZ90_10180Help
Entry
FAZ90_10180       CDS       T06393                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vcc  Vibrio cyclitrophicus
Brite
KEGG Orthology (KO) [BR:vcc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FAZ90_10180 (ahpF)
Enzymes [BR:vcc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FAZ90_10180 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like DAO FAD_oxidored FAD_binding_3 Glutaredoxin NAD_binding_8 Thi4 Lycopene_cycl AlaDh_PNT_C Thioredoxin_9 DUF1640 Thioredoxin_4 Phage_TTP_13 K_oxygenase LPP
Motif
Other DBs
NCBI-ProteinID: QCI71427
LinkDB All DBs
Position
1:2251245..2252837
Genome map
AA seq 530 aa AA seqDB search
MLDQAMKQQLKAYLENLKTNVQLVLSLDNSDTANKLQDLANDIASLTDKIEVIRNDSAST
RSPIMQVVNQEKGTAIGFAGLPMGHEFTSLVLALLHSGGHPIKLEADVIEQVKELDQELN
VEIFISLSCQNCPEVVQAFNMMSAINPLIKTTMIDGAAFQDEVKSRDIMAVPSVFINGEL
FGQGRMSLAEILNKVDSGAAEKKAANLNQQAPFDVLVVGGGPAGSSAAIYAARKGIRTGV
VADRFGGQVMDTMAIENFISVKATTGPKLVASLEEHVKEYGVEVMTEQRAANIIAAEDTE
DGYIHIELESGATLRARTVITSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGLVEHVTVLEFADTLRADQVLIDKANTTPNIEIIKMAQTTRVVG
DGNRVTGLEYKDRNTDELKQIELAGIFVQIGLMPNSEWLKGSKVELSPRGEIEINAHGAT
SMKGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDHLIRNSAPVKEAETA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagcaatgaagcagcagctaaaagcatacctagaaaacctaaaaaccaat
gttcagttagtgctgagccttgataacagcgataccgcaaacaaacttcaagacctagcg
aatgatatcgcctctctcactgacaaaattgaagtaattcgaaatgatagcgcaagcact
cgcagccctatcatgcaggtggtgaaccaagagaaaggtacagcgattggcttcgcaggt
ttaccgatgggtcacgagttcacctcactggtactggcactgcttcatagtggtggtcac
cctatcaagcttgaagctgacgtaatcgagcaagtaaaagaattagatcaagagcttaat
gtcgagattttcatctcgctatcatgccaaaactgtccagaagtagttcaagcgttcaac
atgatgtcggcgattaatcctctgattaagacaaccatgatcgacggcgcagcatttcaa
gacgaagtgaagtctcgcgacatcatggcagtaccgagcgtattcattaacggtgagcta
tttggtcaaggccgtatgtcactggctgaaatattgaacaaagtcgattcaggcgcagca
gaaaagaaagcggcaaacctaaaccaacaagcaccgtttgatgtattggttgtaggcggc
ggccctgcgggttcttcagcggcaatttatgcggcacgtaaaggcattcgcactggtgtt
gttgctgaccgattcggtggtcaagtgatggataccatggcgattgagaactttatctca
gtaaaagcaaccaccggtcctaagttagtcgcaagcttagaagagcacgtaaaagagtac
ggtgttgaggtaatgactgagcagcgtgcagcgaacatcatcgcagcagaagacacagaa
gacggttacatccatattgagttagaaagcggtgcaacactgcgagctcgtacggtgatc
accagtactggtgcgcgctggcgtgaaatgaacgttccgggtgagcaagagtaccgcaat
aaaggtgtcgcttactgcccacactgtgacggtcctttgttcaaaggtaagaaaacagcg
gttattggtggcggtaactcaggtatcgaagcggcgattgacttggctggtctcgttgaa
cacgtaaccgtacttgaatttgcagacacactacgtgctgaccaagtgcttatagacaaa
gcgaacacgacaccgaacatcgaaatcatcaaaatggctcaaacaacacgagtggttggt
gatggtaatcgagtaacgggtctggaatacaaagaccgcaacaccgatgaacttaaacag
atcgaactagcaggtatctttgttcaaatcggcctgatgccaaacagtgaatggttgaag
ggttcaaaagttgagctttcaccacgcggtgaaattgaaattaacgctcatggtgcaaca
tcaatgaaaggtgtattcgcagcgggtgatgtaacaacagtgccttacaaacaaatcatc
attgcgatgggtgaaggtgcaaaagcaagtttaggtgcatttgaccacctaatccgtaac
tcagctccggttaaagaagctgaaaccgcttaa

DBGET integrated database retrieval system