KEGG   Vibrio cyclitrophicus: FAZ90_22055
Entry
FAZ90_22055       CDS       T06393                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vcc  Vibrio cyclitrophicus
Pathway
vcc00473  D-Alanine metabolism
vcc00550  Peptidoglycan biosynthesis
vcc01100  Metabolic pathways
vcc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FAZ90_22055
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FAZ90_22055
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FAZ90_22055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcc01011]
    FAZ90_22055
Enzymes [BR:vcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FAZ90_22055
Peptidoglycan biosynthesis and degradation proteins [BR:vcc01011]
 Precursor biosynthesis
  Amino acid ligase
   FAZ90_22055
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK ATPgrasp_ST
Other DBs
NCBI-ProteinID: QCI73673
LinkDB
Position
2:complement(1548137..1549132)
AA seq 331 aa
MNTTNILLLCGGGSSEHEVSLVSANYLFAQLDSVADFNVVRVEIKSEGWCLDSGELVYLD
INDQTLRGDNFESKVEFIVPCIHGFPGETGDIQSLFEMAKIPYLGCGSEASNNSFNKITS
KLWYDALGIPNTPYLFLSDNTEQTHAQATQAFETWGKVFVKAARQGSSVGCYQVNEVEEL
SEAIDKAFTFSDQVLIEKSVVPRELEVAAYEIDGELHISKPGEVIAPNGAFYSYEEKYSA
DSHSITEVEASNLTDEQRELIADSARKVFTQMKLRHLSRIDFFLTQDNEIYLNEVNTFPG
MTPISMFPKMVEHDGHKFSQFLENCVRTSLA
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaacaccacaaacatccttcttctttgcggcggtggatcttcagagcatgaagtgtct
ttagtttcagccaattatctttttgcacagctcgacagcgttgctgattttaacgttgtg
agagttgaaattaagagtgaaggttggtgtctagattctggtgaattagtttaccttgat
attaacgatcaaacactacgtggcgataacttcgagtctaaagtcgaattcattgtacct
tgtattcacgggtttcctggcgaaacaggtgacatccagtcattgtttgaaatggctaag
attccgtatctaggttgtggctctgaagcgagtaacaatagctttaacaagatcacttca
aagctttggtacgatgcacttggtatcccaaacacaccttacttgttcctatcagacaac
acagaacaaacacacgcacaagcaacccaagcttttgaaacttgggggaaagtcttcgta
aaagccgctcgccaaggctcttctgttggttgttaccaggtaaatgaagttgaagaactg
agtgaagcgatcgataaggcgtttaccttctcagatcaagtacttattgaaaagtcagtc
gtaccaagagagctagaagttgccgcatatgaaatcgatggtgagctacacattagtaag
ccaggcgaagtgattgcaccaaatggcgcattctactcatatgaagagaaatacagcgca
gacagtcactcaatcactgaagtggaagcaagtaatctaacggatgagcagcgtgaattg
attgcagacagtgcacgcaaagtatttacacaaatgaagctacgtcacttgtctcgtatt
gatttcttcttaacgcaagacaacgagatctacctaaatgaagtcaatactttcccaggt
atgacgccaatttctatgttccctaaaatggttgaacacgatggacataaatttagccag
ttcttagaaaactgcgtaagaaccagtcttgcttag

DBGET integrated database retrieval system