KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1040Help
Entry
Vch1786_I1040     CDS       T01650                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce03030  DNA replication
vce03410  Base excision repair
vce03420  Nucleotide excision repair
vce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Vch1786_I1040
   03410 Base excision repair
    Vch1786_I1040
   03420 Nucleotide excision repair
    Vch1786_I1040
   03430 Mismatch repair
    Vch1786_I1040
Enzymes [BR:vce01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Vch1786_I1040
    6.5.1.6  DNA ligase (ATP or NAD+)
     Vch1786_I1040
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Vch1786_I1040
DNA replication proteins [BR:vce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Vch1786_I1040
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Vch1786_I1040
DNA repair and recombination proteins [BR:vce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Vch1786_I1040
   NER (nucleotide excision repair)
    Other NER factors
     Vch1786_I1040
   MMR (mismatch exicision repair)
    Other MMR factors
     Vch1786_I1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AET26644
LinkDB All DBs
Position
1:complement(1128367..1129215)
Genome map
AA seq 282 aa AA seqDB search
MLIRLTLTAAAIMLAQQTLANDGPLAFIPITYANNYQHGIDIFDYWKSEKLDGIRAIWTG
KQLVTRNGNPIAAPAWFTESLPSYSLEGELWAGRGNFSLVQQTVLDSQPADSAWRKISLM
LFDMPDAAGDYSKRYYNLIHLVNSLDLKHIRYVEHTPIKSEAELLSYLDNISEKSGEGVM
LRKISARYQAGRSNDLLKLKRHQDAEATVIGYRLGMGKYKGKMGSMLVRTAEGLEFYIGS
GFSDVERAEPPKIGSVITYRYNGLTTEGKPRFARFVRVRENY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcttatacgactgacgctcaccgctgccgcgatcatgctggcccagcaaacgctggcc
aatgatgggccgctggcttttattccaattacttacgccaacaactaccaacacggcatt
gatattttcgattactggaaaagtgagaagcttgacggtatccgcgcgatttggacgggg
aaacaactggtcactcgtaacggtaaccctattgctgcccccgcttggtttaccgagtcg
ttaccctcttattcactcgaaggtgaattgtgggcagggcgcggcaatttctcactggta
cagcaaacggttttagatagccaaccggctgactccgcatggcgcaaaatcagcctaatg
ctgttcgatatgcctgatgcggcgggcgattacagtaagcgctattacaacctcatccat
ttggtgaatagccttgatctcaagcatatccgatatgtcgaacacaccccgataaaatct
gaggcggaactgctttcctaccttgataacatcagtgagaaatcgggggaaggggtaatg
ctgcgcaaaatcagcgctcgctatcaggcagggcgaagtaatgatttgttgaagctgaaa
aggcatcaggatgcagaagcaaccgtgattggttatcggctcggcatgggaaaatacaaa
ggtaaaatgggctctatgctggttcggaccgcagaggggctagaattttatatcggcagt
ggatttagtgatgtcgagcgcgccgagccgcccaagattggtagtgttatcacctaccgt
tacaacggacttacaacggaaggcaaaccaaggtttgcccgttttgttcgggtcagagaa
aactattga

DBGET integrated database retrieval system