KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1469Help
Entry
Vch1786_I1469     CDS       T01650                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00220  Arginine biosynthesis
vce00250  Alanine, aspartate and glutamate metabolism
vce00290  Valine, leucine and isoleucine biosynthesis
vce01100  Metabolic pathways
vce01110  Biosynthesis of secondary metabolites
vce01130  Biosynthesis of antibiotics
vce01210  2-Oxocarboxylic acid metabolism
vce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Vch1786_I1469
   00290 Valine, leucine and isoleucine biosynthesis
    Vch1786_I1469
   00220 Arginine biosynthesis
    Vch1786_I1469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vce01007]
    Vch1786_I1469
Enzymes [BR:vce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Vch1786_I1469
    2.6.1.66  valine---pyruvate transaminase
     Vch1786_I1469
Amino acid related enzymes [BR:vce01007]
 Aminotransferase (transaminase)
  Class I
   Vch1786_I1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AET27069
LinkDB All DBs
Position
1:1600654..1601868
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQYYQKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYICDEEADWYPDLDDIRSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIIEIARKHKLMIFADEIYDKVLYDGAVHTSIATLADDVLVVTFNGLSK
AYRVCGFRGGWMFLTGPKQQAQGYIAGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGISCVKPKGAMYLFPKIDTKMYPIKDDQKMVLDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFERFITTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattcgaggacca
gtgcttaaacatgctaaacgcatggaagaagaagggcataaaatactgaagcttaacatc
ggtaaccctgccccgtttggtttcgacgccccagacgagatcctagtcgatgtgatccgt
aacctacctacttcacaaggttactgtgactcgaaaggcatttattccgctcgtaaagcg
gtggtgcagtactaccagaaaaaaggtatccgcagtctggacgtcgaagatgtgtacatc
ggcaacggtgcatcagagcttatcgtgatggcgatgcaagccctgctcaacaatggcgat
gaaatgctggtacctgcccctgattacccactgtggacagccgcggtagcactttctggc
ggcaaagccgtgcactacatctgtgatgaagaagccgattggtatcctgacctcgacgat
attcgcagcaaaatcaccccgaaaacccgtggcattgtgctgatcaaccccaataaccca
accggtgcggtttacagtcgtgatttcttgctggaaatcatcgagattgctcgcaagcac
aagctgatgattttcgccgatgagatttacgacaaagtgctgtacgacggcgcggtgcat
acctcaatcgccaccttagcggatgatgtattagtcgtcaccttcaacggcttatccaaa
gcttaccgtgtttgtggtttccgtggtggctggatgttcctgactggccccaaacagcaa
gcacaaggctatattgcagggctcgatatgctggcctcgatgcgcttgtgtgccaacgtg
ccaatgcaacatgccattcaaaccgcactcggcggctatcaaagtatcaatgagctgatt
ttgccgggcggccgactgctggaacagcgtgatcgcgcatgggagctgattaaccagatc
ccggggatttcttgcgtgaagccaaaaggcgcgatgtacctgttcccgaaaattgatacc
aaaatgtatccgatcaaagatgaccagaaaatggtgcttgatttcctagtgcaagaaaaa
gtgctgctagtacaaggcagcggctttaactggccaaaaccggatcacttccgcattgtg
actctgcctcatgtggaagatctggaaatcgccatcagtcgctttgaacgctttatcacg
acttacagccaataa

DBGET integrated database retrieval system