KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1581Help
Entry
Vch1786_I1581     CDS       T01650                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00020  Citrate cycle (TCA cycle)
vce00190  Oxidative phosphorylation
vce00650  Butanoate metabolism
vce01100  Metabolic pathways
vce01110  Biosynthesis of secondary metabolites
vce01120  Microbial metabolism in diverse environments
vce01130  Biosynthesis of antibiotics
vce01200  Carbon metabolism
Module
vce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vce_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vch1786_I1581 (sdhB)
   00650 Butanoate metabolism
    Vch1786_I1581 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Vch1786_I1581 (sdhB)
Enzymes [BR:vce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Vch1786_I1581 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Vch1786_I1581 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AET27179
LinkDB All DBs
Position
1:complement(1720954..1721664)
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDNKPYMKDYILEVEEGSDMMVLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALKGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
ADDALPPSRENLQSPEERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSNLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLINRSV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaacttctccttatatcgctataatccggatgtcgataacaaaccctacatg
aaagactacattcttgaggtagaggaagggtctgacatgatggtgttggatgctttgatt
ctgcttaaagagcaagatccaagtattgctttccgccgctcatgccgtgaaggggtttgt
ggctcggacggtctgaatatgaatggtaagaatggcttagcatgtatcacacctttgtct
gcgttaaaaggtgacaaaattgtgattcgtccgctgccaggattacctgtggttcgtgac
ttgattgtcgacatgactcagttttacgataactatgcgaaagttaagcctttcttgatt
gcagatgatgcattacccccttcaagagagaacttgcaatccccagaagaacgggcgcat
ttggatggtctgtacgagtgtattatgtgcgcttgctgtaccacttcctgcccttcattc
tggtggaatccggataaatttatcggacctgcaggtttgttggctgcttatcgttggttg
attgatagccgtgataccgcgacagatgaacgcttatcgaatcttgatgatgcgtttagc
gtttttcgttgccacggcatcatgaactgtgtcagtgtttgtccgaaaggattaaaccca
acgaaagccattggacatattaagtccatgttgatcaatcgttcagtttaa

DBGET integrated database retrieval system