KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1588
Entry
Vch1786_I1588     CDS       T01650                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00010  Glycolysis / Gluconeogenesis
vce00030  Pentose phosphate pathway
vce00052  Galactose metabolism
vce00230  Purine metabolism
vce00500  Starch and sucrose metabolism
vce00520  Amino sugar and nucleotide sugar metabolism
vce00521  Streptomycin biosynthesis
vce01100  Metabolic pathways
vce01110  Biosynthesis of secondary metabolites
vce01120  Microbial metabolism in diverse environments
Module
vce_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vch1786_I1588
   00030 Pentose phosphate pathway
    Vch1786_I1588
   00052 Galactose metabolism
    Vch1786_I1588
   00500 Starch and sucrose metabolism
    Vch1786_I1588
   00520 Amino sugar and nucleotide sugar metabolism
    Vch1786_I1588
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Vch1786_I1588
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Vch1786_I1588
Enzymes [BR:vce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Vch1786_I1588
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-ProteinID: AET27186
LinkDB
Position
1:complement(1727559..1729205)
AA seq 548 aa
MAMHPRAGQKARQEDLHNIPALVANYYLLQPEAGNTAHKVEFGTSGHRGTADKTTFNEHH
ILAIAQAVADVRHEHGVTGPIFIGKDTHALSEPAFSSVLEVLIANGIEVIVQENNGYTPT
PGISHAILTYNLKHADKADGIVITPSHNPPQDGGIKYNPPHGGPAEGELTQAIEDRANAY
ISQQLAGVKRMPIALAKQSELLKQVDLVKPYVDDLVNVVDMAAIQKAKLKIGVDPLGGSG
IDYWRQIGNAYQLDLTLVSEAIDPSFQFMSLDKDGVIRMDCSSPYAMAGLLALKDEYDLA
FGNDPDYDRHGIVTPKGLMNPNHFLAVCIDYLYRHRQGWAGHVAVGKTLVSSAMIDKVVA
DLGRELCEVPVGFKWFVDGLYSGRFGFGGEESAGASFLRQDGTPWSTDKDGIILCLLAAE
ITAVTGKNPQQYYDELAAKHGDFYYSRIQAVANGPQKNVLKKLSPEMVSAQTLAGDAITA
RLTHAPGNGAAIGGLKVTTDYGWFAARPSGTEDIYKIYCESFKGAEHLKQIESEAQQIVN
QVFKDAGL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggctatgcaccctcgtgctggacaaaaggcgcgacaagaggatctccataatatccct
gcgctagttgcaaattactacctactccagcctgaagctggcaatacggcgcataaagtt
gaatttggtacgtcgggacaccgaggtacggccgataaaactacctttaatgagcatcat
attcttgcgattgcgcaagcggtagcggatgtgcgccatgaacatggtgtgactggccca
atctttattggcaaagatactcatgcgctgtctgaacctgcattcagtagtgttctggaa
gtgttgattgccaatggcattgaagtgattgtgcaagaaaacaacggttacacaccaacg
ccgggcatttcacacgctattttaacgtacaacctgaagcatgcagataaagcggacggc
attgtgattaccccttcgcacaacccgccacaagatggtggcatcaaatacaacccacca
cacggtggcccggcggaaggggagttaacccaagcgattgaagatcgtgccaatgcttac
atcagtcagcagcttgctggtgtaaaacgcatgccgattgcgttggctaaacaatccgag
ttgctcaagcaagtcgatttggttaagccttacgttgatgatctggtcaatgtggttgat
atggcggcaatccaaaaggccaagctcaaaattggggtcgatcctctgggtggcagtggc
attgattactggcgtcaaattggcaacgcttaccaactcgatttaacgctggtcagcgaa
gccattgatccaagcttccaattcatgtcattagataaagatggcgtgatccgtatggat
tgctcttctccatatgccatggcgggtttgctggccctgaaagatgaatacgacttggct
tttggtaacgatcctgactacgaccgtcacggcattgtgacccctaaaggcttgatgaat
ccgaatcacttcctcgcggtgtgcattgattatctgtaccgtcatcgtcaaggttgggcg
ggccatgttgccgtcggtaaaacgctggtttccagtgcgatgattgataaagtggttgcc
gatcttggccgcgaactgtgtgaagttccagtaggcttcaaatggtttgttgatggactc
tactctggtcgctttggttttggcggtgaagagagtgcgggggcttctttcctgcgtcaa
gatggcacgccttggtctaccgacaaagatgggatcattttgtgcttactggcagcggaa
attaccgctgtgaccggcaaaaatccgcaacagtattatgatgaattggcagctaaacac
ggtgatttttattacagccgtattcaagccgtggcgaatggtccacagaagaatgtgcta
aagaaactgtctcctgaaatggtgtcggctcaaacgctagcgggagatgcaattacggct
cgcttgactcatgctccgggtaatggcgcagccattggcggcctcaaagtgactacggat
tatggttggtttgcggctcgtccatctggcacagaagatatctataagatttattgtgag
agcttcaaaggggctgagcacttaaaacaaattgaatctgaagcgcagcagatcgtaaac
caagtgtttaaagacgcgggtttataa

DBGET integrated database retrieval system