KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2142Help
Entry
Vch1786_I2142     CDS       T01650                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00620  Pyruvate metabolism
vce00680  Methane metabolism
vce01100  Metabolic pathways
vce01120  Microbial metabolism in diverse environments
vce01200  Carbon metabolism
Module
vce_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vch1786_I2142
  09102 Energy metabolism
   00680 Methane metabolism
    Vch1786_I2142
Enzymes [BR:vce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Vch1786_I2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AET27726
LinkDB All DBs
Position
1:2288669..2291299
Genome map
AA seq 876 aa AA seqDB search
MNEKYAALKSNVSMLGRLLGQTIQAADGDVILAKVETIRKLSKSARAGNQADRELLIEEI
KNLPNHQLTPVARAFNQFLNLTNIAEQYHTISRHCESHVNELDAIGSLFAKLAQKSVSKF
DTAQAIRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSPKERHKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWHAVPEFLRELDEQVKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHTITREVLLLSRWKAADLYLTDINELVSELSMTKCNEAVR
ALAGEEHEPYRAILKPIRSLLQETIEILDAKLNGQKLAVKAPLQTADQLWEPLYACYQSL
HECGMGVIADGSLLDTLRRIKAFGVHLVRLDVRQESSRHAEVISELTRHLGIGDYNQWSE
QDKIAFLTTELNSKRPLLPRDWQPSPQVKEVLDTCKIIAAQSKDAFGAYVISMARTASDV
LAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIRQLMNIDLYRGFIQNHQMVMIGYSD
SAKDAGVMAAGWAQYRAMEALVKVGEEAGIELTLFHGRGGTIGRGGAPAHAALLSQPPKS
LKGGLRVTEQGEMIRFKLGLPEVAVNSFNMYASAILEANLLPPPEPKNEWRALMDILSEI
SCNAYRKVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPTGGVESLRAIPWIFSWSQ
NRLILPAWLGAGEAIQIAINEGHQALLEEMCREWPFFSTRLGMLEMVYTKCSVSIACHYD
ERLVEPTLRPLGEKLRAQLQQDIKVVLNVENNENLMQSDPWGQESIRLRNIYIEPLNMLQ
AELLYRTRQSELPAPELEEALMVTIAGIAAGMRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaatacgctgcgctcaaaagtaacgtaagcatgttaggacgactactcggc
cagacaattcaagccgccgatggtgacgttattttagcgaaagtggaaaccatccgaaaa
ctttccaaatctgcccgagcgggcaaccaagcagaccgcgagctgctgatcgaagagatc
aaaaatcttcctaaccaccaactgactcccgtggctcgcgcctttaaccaattcctgaac
ctgaccaatattgccgagcagtatcacaccatctcacgccactgtgaaagccacgtgaat
gagttggatgcgattggtagcctgtttgctaaactggcgcagaagtcggtcagtaaattc
gatacggcgcaagccattcgcgatctcaacattgaactggtattgaccgctcacccgact
gagatcactcgtcgcaccatgatcaacaagctagtcaaaatcaacgaatgtctgtccaaa
cttgagctcagcgacctctctccgaaagagcgccataaaaccgagcgccgccttgagcaa
ttaattgcccaaagttggcattcagatgtgattcgtcagcagcgtccaacgccattagat
gaagccaaatgggggttcgcggtcgtagaaaactcactgtggcacgccgttcctgagttt
ttgcgtgagttagatgaacaggtgaaatcttacctaggtgaaggtttaccgattgatgca
cgccctgtgcatttctcatcttggatgggtggagatcgcgatggtaacccctttgtgacc
cacactatcactcgcgaagtgctgttactgtcacgctggaaagcagccgatttgtatctc
accgatatcaatgaactggtcagcgaactttcgatgaccaagtgtaatgaagccgtacgc
gctttagccggcgaagagcacgaaccttatcgcgccatcctcaagccaatacgaagcttg
ctgcaagagacgattgaaattcttgatgcaaaactcaacggccaaaaactggcagtaaaa
gcccctttgcaaaccgcagatcagttgtgggaaccgctctacgcgtgttaccaatcactg
catgagtgtggcatgggcgtaatcgcagatggttccttgctcgataccctgcgccgcatt
aaagcctttggcgtgcatctggttcgcctcgatgttcgtcaagagagctcacgccatgca
gaagtgatctcggaactgacccgtcatctcggcatcggcgattacaatcagtggagcgag
caagataaaatcgcgttcctgaccacagagctgaactcgaaacgcccactgctaccacgc
gattggcaaccgtcgcctcaagtcaaagaggtgttggatacctgtaagatcatcgctgcg
cagtccaaagatgcctttggcgcttatgtcatttcgatggcgcgtaccgcatcggatgtc
ctcgccgtgcacctgctgctgcaagaggcaggatgtccttatcgtatggatgtttgcccg
ctgtttgaaaccttagatgacttgaacaatgcagaatcggtgatccgtcaactgatgaac
atcgatctgtatcgcggctttattcagaaccaccaaatggtgatgattggttattccgat
tccgccaaagatgcgggggtgatggcagcaggctgggcgcaataccgagcgatggaagcg
ctagtgaaagttggcgaagaagcggggatcgaactcactctattccatggtcgcggcggc
acaattggtcgcggcggtgctcctgcacacgcggcactgctttctcagccaccaaagagt
ttgaagggcggtctgcgtgtaaccgaacaaggcgaaatgatccgctttaaactgggtcta
cctgaagtggcggtcaacagctttaacatgtacgccagcgctattttggaagccaactta
ctacccccaccagagcctaaaaatgagtggcgtgcgctgatggatattctgtcggaaatt
tcatgtaatgcttaccgaaaagtcgtgcgtggtgaaccagactttgttccttacttccgt
caagccacaccagaattagaactcggcaagctgccattgggttccagacccgccaaacgt
aatcctactggtggagtcgagagcctgcgagccattccatggatcttctcatggagccag
aatcgtctcattcttcctgcttggctaggtgcgggtgaagcgatccaaattgccattaat
gaaggacaccaagcgctacttgaagagatgtgccgcgaatggccattcttctcaactcgc
cttggcatgctggaaatggtgtacaccaaatgcagtgtaagcatcgcgtgtcattatgat
gagcgacttgttgaaccgactttgcgtccattgggtgaaaaattgcgtgctcaattacag
caagacattaaagttgtgctgaacgttgagaataacgagaacctgatgcaaagcgatcct
tggggacaagagtcgattcgtctgcgtaacatctatattgaaccactcaacatgctgcaa
gcagaactgctgtatcgtacccgtcaatcagaacttcctgctccagaactggaagaagcc
ttgatggtgaccattgcgggaattgcggcgggaatgcgcaatactggttaa

DBGET integrated database retrieval system