KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2240
Entry
Vch1786_I2240     CDS       T01650                                 

Gene name
glnA
Definition
(GenBank) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00220  Arginine biosynthesis
vce00250  Alanine, aspartate and glutamate metabolism
vce00630  Glyoxylate and dicarboxylate metabolism
vce00910  Nitrogen metabolism
vce01100  Metabolic pathways
vce01120  Microbial metabolism in diverse environments
vce01230  Biosynthesis of amino acids
vce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Vch1786_I2240 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Vch1786_I2240 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Vch1786_I2240 (glnA)
   00220 Arginine biosynthesis
    Vch1786_I2240 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Vch1786_I2240 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vce04147]
    Vch1786_I2240 (glnA)
Enzymes [BR:vce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     Vch1786_I2240 (glnA)
Exosome [BR:vce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vch1786_I2240 (glnA)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-ProteinID: AET27824
LinkDB
Position
1:2389241..2390650
AA seq 469 aa
MSVENVLSLIQENEVKFVDLRFTDTKGKEQHISIPAHQIDADFFEDGKMFDGSSVAGWKG
INESDMVMMPDPSSAVLDPFTEDATLNIRCDILEPATMQGYDRDPRSIAKRAEEYMRSTG
IADTVLVGPEPEFFLFDDVKFATNMSGSFFKIDDVEAAWNTGTEYEDGNKGHRPGVKGGY
FPVAPVDSSQDIRSAMCLIMEEMGLVVEAHHHEVATAGQNEIATRFNTLTTKADEIQIYK
YVVHNVAHAFGKTATFMPKPLVGDNGSGMHVHQSLAKDGVNLFAGDKYGGLSETALYYIG
GIIKHARALNAITNPSTNSYKRLVPHYEAPVMLAYSARNRSASIRIPVVPSPKARRIEVR
FPDPAANPYLAFAAMLMAGLDGIKNKIHPGEAMDKDLYDLPAEEAAEIPKVAESLQQALQ
YLDADREFLTAGGVFSDDFIDSYIALKTKDVERVNVAVHPLEFELYYSV
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtcagtagaaaatgttttatcgctgatccaagaaaacgaagttaagtttgttgaccta
cgcttcacagacaccaagggtaaagaacaacatatctctatccctgctcaccaaattgat
gctgacttcttcgaagacggtaaaatgttcgatggttcttctgtggctggctggaaaggt
atcaacgaatccgacatggtgatgatgccagatccatcttccgctgtgctcgacccattc
actgaagatgctacgctgaacattcgttgtgacatcttagaacctgcgactatgcaaggt
tacgatcgtgacccacgttctatcgcaaaacgtgcagaagaatatatgcgctctacgggt
atcgcagacacagttcttgtcggtccagagccagaattcttcctgtttgacgatgtgaaa
ttcgccaccaacatgtctggttcattcttcaagattgacgacgtagaagcggcatggaac
acaggtactgaatacgaagatggtaacaaaggtcaccgtccaggcgtaaaaggcggttac
ttcccagttgctcctgttgactcatcacaagacatccgctcagcgatgtgtttgatcatg
gaagaaatgggtctggttgttgaagcgcaccaccatgaagtagccactgcgggtcagaac
gaaatcgcgactcgctttaacacgctcaccacgaaagcagacgagatccaaatctacaag
tacgttgtacacaacgttgcgcacgcttttggtaaaacagccacctttatgcctaagcca
ctggttggcgataacggctcaggtatgcacgttcaccaatctctcgcgaaagacggcgtt
aacctgtttgcgggtgataagtacggcggcctatctgaaaccgcactgtactacattggt
ggtatcatcaagcacgctcgcgcgctgaatgcgatcactaacccatccaccaactcctac
aagcgtctggttcctcactatgaagcaccagtaatgctggcttactctgcgcgtaaccgt
tcggcatctatccgtatcccagtggtaccaagcccgaaagcacgtcgtattgaagttcgc
ttcccagatccagcagctaacccatacttggcgtttgcagctatgctgatggcgggtctt
gacggtatcaagaacaagatccacccaggagaagcgatggacaaagatctgtatgactta
ccagcagaagaagcggcagagattccaaaagtagcggaatcactgcaacaagctctgcag
tatctggatgcagaccgtgagttcctcactgccggtggcgtgttctcagatgacttcatt
gattcttacatcgcactgaagaccaaagatgttgagcgcgtgaacgttgctgttcatcca
cttgagtttgaactgtactactctgtgtaa

DBGET integrated database retrieval system