KEGG   Vibrio cholerae O1 biovar El Tor FJ147: IR04_15030Help
Entry
IR04_15030        CDS       T03827                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vcf  Vibrio cholerae O1 biovar El Tor FJ147
Pathway
vcf00220  Arginine biosynthesis
vcf00250  Alanine, aspartate and glutamate metabolism
vcf00290  Valine, leucine and isoleucine biosynthesis
vcf01100  Metabolic pathways
vcf01110  Biosynthesis of secondary metabolites
vcf01130  Biosynthesis of antibiotics
vcf01210  2-Oxocarboxylic acid metabolism
vcf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IR04_15030
   00290 Valine, leucine and isoleucine biosynthesis
    IR04_15030
   00220 Arginine biosynthesis
    IR04_15030
Enzymes [BR:vcf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     IR04_15030
    2.6.1.66  valine---pyruvate transaminase
     IR04_15030
Amino acid related enzymes [BR:vcf01007]
 Aminotransferase (transaminase)
  Class I
   IR04_15030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKA00419
UniProt: A0A2L2M6E7
LinkDB All DBs
Position
I:2212539..2213753
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQYYQKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYICDEEADWYPDLDDIRSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIIEIARKHKLMIFADEIYDKVLYDGAVHTSIATLADDVLVVTFNGLSK
AYRVCGFRGGWMFLTGPKQQAQGYIAGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGISCVKPKGAMYLFPKIDTKMYPIKDDQKMVLDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFERFITTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattcgaggacca
gtgcttaaacatgctaaacgcatggaagaagaagggcataaaatactgaagcttaacatc
ggtaaccctgccccgtttggtttcgacgccccagacgagatcctagtcgatgtgatccgt
aacctacctacttcacaaggttactgtgactcgaaaggcatttattccgctcgtaaagcg
gtggtgcagtactaccagaaaaaaggtatccgcagtctggacgtcgaagatgtgtacatc
ggcaacggtgcatcagagcttatcgtgatggcgatgcaagccctgctcaacaatggcgat
gaaatgctggtacctgcccctgattacccactgtggacagccgcggtagcactttctggc
ggcaaagccgtgcactacatctgtgatgaagaagccgattggtatcctgacctcgacgat
attcgcagcaaaatcaccccgaaaacccgtggcattgtgctgatcaaccccaataaccca
accggtgcggtttacagtcgtgatttcttgctggaaatcatcgagattgctcgcaagcac
aagctgatgattttcgccgatgagatttacgacaaagtgctgtacgacggcgcggtgcat
acctcaatcgccaccttagcggatgatgtattagtcgtcaccttcaacggcttatccaaa
gcttaccgtgtttgtggtttccgtggtggctggatgttcctgactggccccaaacagcaa
gcacaaggctatattgcagggctcgatatgctggcctcgatgcgcttgtgtgccaacgtg
ccaatgcaacatgccattcaaaccgcactcggcggctatcaaagtatcaatgagctgatt
ttgccgggcggccgactgctggaacagcgtgatcgcgcatgggagctgattaaccagatc
ccggggatttcttgcgtgaagccaaaaggcgcgatgtacctgttcccgaaaattgatacc
aaaatgtatccgatcaaagatgaccagaaaatggtgcttgatttcctagtgcaagaaaaa
gtgctgctagtacaaggcagcggctttaactggccaaaaccggatcacttccgcattgtg
actctgcctcatgtggaagatctggaaatcgccatcagtcgctttgaacgctttatcacg
acttacagccaataa

DBGET integrated database retrieval system