KEGG   Vibrio cholerae O1 El Tor FJ147: IR04_17125Help
Entry
IR04_17125        CDS       T03827                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
vcf  Vibrio cholerae O1 El Tor FJ147
Pathway
vcf00550  Peptidoglycan biosynthesis
vcf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IR04_17125
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    IR04_17125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcf01011]
    IR04_17125
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vcf03036]
    IR04_17125
Enzymes [BR:vcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IR04_17125
Peptidoglycan biosynthesis and degradation proteins [BR:vcf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   IR04_17125
Chromosome and associated proteins [BR:vcf03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    IR04_17125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKA00812
LinkDB All DBs
Position
I:complement(2662124..2663866)
Genome map
AA seq 580 aa AA seqDB search
MKKKAPAKASRVSPRVTTAEPAPIFIRWRFYLLLFFVLTAFCALVARVAYIQIIEPDNLI
KEGDLRSIRAKTLQSARGIISDRNGEALAVSVPVEAVWADPVAIYKEGGLVEKDRWYALA
DVLGLDRQEMMKKIEDNRSRRFIYLQRQVSPAMAKYIRELKLAGIGLKEESRRYYPAGEV
SAHLVGVTGIDGHGLEGVERSFDSTLTGESGKSVTRKDKFGRVVENIALEEREEGKPIQL
TIDQRLQAIAFRAVKQAMADYRATSASAVMLDVKTGAVLAMVNAPSYNPNNRNDWQSFKM
RNRVITDAFEPGSTVKPFVVLAALANGIADKNTIIDTGDGTMQIGGSRVRDTSKVGKADL
TLILKKSSNIGVAKLALEMPLEALLGMYSSVGLGEMSGLDLVGETIGIFPNRRRWSQFEI
ATLSFGYGLAITPIQLAHAYATLGNHGKYQPIHIIKGDQHGETRQVVDPKYVNQVLEMLE
TVTQPGGTATRAAVPGYRIAAKSGTSRKAIAGGYSDEYFAYTAGVAPVSDPRISLVVMVN
EPQGDSYYGGAVAGPVFSEIMKGALQILNIAPDENRFQNK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaagccccagccaaagcctcccgagtttctccccgtgttaccacggctgag
cctgcacctatctttatccgctggcgtttctatctgctgctgttttttgtgctaacggcg
ttctgcgctttggttgcacgagtggcttatatccaaattattgaacctgacaatctgatt
aaagaaggggatttgcgctcgattcgcgccaaaaccttgcaatcagcgcgcggcattatt
tccgatcgtaatggcgaagcgttagcggtgagtgtgccagtcgaagcggtctgggccgat
cctgtcgctatttataaagaaggcggtctggttgagaaagaccgttggtatgcgctggcc
gatgtgctcggactggatcgtcaggagatgatgaagaaaatcgaggataaccgttcgcgc
cgctttatctatctgcaacgtcaggttagccctgcgatggccaaatacatccgtgaactc
aaattagcggggattggcctaaaagaagagtcacgccgctattatcccgcaggtgaggtg
agtgcccacttagtcggggtgaccggaattgatggccacggtcttgaaggggtagagcgc
agctttgatagcaccttaacgggtgagtcaggtaaaagcgtgacgcgtaaagataagttc
gggcgagtggtggaaaacattgccctggaagagcgtgaagaaggtaagcctatccagctc
accattgaccagcgcttacaagcgatcgcttttcgtgccgtgaaacaggcgatggcggat
tatcgtgcgacttctgcatcggcagtgatgttggatgtgaaaaccggcgcggtactggcg
atggtgaatgcgccttcttacaacccgaataatcgcaatgactggcaaagctttaaaatg
cgtaaccgagtgataaccgatgcgtttgaacccggttcaacggttaagccttttgtggtc
ttggcggcgctcgccaatggtatcgccgacaaaaacaccatcatagataccggagatggc
accatgcagattggcggtagccgcgtgcgtgatacctccaaagttggcaaagccgatctc
acgctgattttgaaaaagtcgagcaacattggtgtggctaaattagccttagaaatgccg
ttagaggcgttattgggcatgtatagctcggtgggcttgggcgaaatgtctggcttggat
ttggtgggcgaaacgatcggtattttcccgaatcgccgccgttggtcacagtttgaaatc
gccaccttatcgtttggctatggtttggcgatcacgcctattcagttggctcacgcctac
gcgaccttaggcaatcatggtaaataccaacctattcatattattaaaggtgatcaacat
ggcgagacgcgccaagtggttgatcctaaatatgtcaatcaggtgctcgaaatgctggaa
acggtaactcagcccggcggaacggcaacgcgtgcagcggtaccggggtatcgtattgcg
gccaaatccggtacgtcacgtaaagcgattgcgggcggttatagtgatgaatattttgcc
tacaccgcaggggtggctccggtgagcgacccaagaatttcactggtggtcatggtcaat
gagccgcaaggcgactcttactatggcggcgcagtggccggtccggttttctcggaaatc
atgaagggcgcattacaaatcctcaacattgctcctgatgaaaaccgcttccaaaacaaa
taa

DBGET integrated database retrieval system