KEGG   Vibrio cholerae O1 El Tor FJ147: IR04_17360
Entry
IR04_17360        CDS       T03827                                 

Definition
(GenBank) diguanylate cyclase
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vcf  Vibrio cholerae O1 El Tor FJ147
Pathway
vcf05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    IR04_17360
Enzymes [BR:vcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     IR04_17360
SSDB
Motif
Pfam: GGDEF HAMP DUF4276
Other DBs
NCBI-ProteinID: AKA00856
UniProt: A0A6M4VC42
LinkDB
Position
I:complement(2721978..2723270)
AA seq 430 aa
MTDQTRTSPLVNRLLKMISLCALGYLLIILAIIIPRGIQSVEQQKQELEEKLALSLSNSA
AIALYVNNYDIASEVMDALLLHQEINAVKLASVDGIVFERTTIPSTYKEQNYWSDANRYR
LDSPVDGNLIGYLMIHEDHQVIRQQAINQILDQIAVVLIQFLVTFIALIWIVRRLVGKPL
TDLSQALSEVRPDHDRKVAVAAEDHHNEIGLVAKSINEFIDASHQALLRERELRQQIERW
ESYYRTIAEQDTLTGLKNRLGCEKFVLRKQRASTTMVLLLIDLDGFKQVNDTLGHAAGDE
VLREIAKRFYALAQTHFSDFVVGRLGGDEFAIYIPLDEFVAESIERFAAQLIESSSEPIG
LGQQSAQVGCSIGISHMNSLHIDLEKLLLQADKAMYWVKYRGKHGYHIYRMGEEILPLPS
AKELKQDQFR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgactgatcaaacgcgaacttcgccactggttaatcgcttgctgaagatgatttcactg
tgtgcacttgggtatttgctgatcattttggccatcattattccgcgcggcatacagagt
gttgagcagcaaaaacaagagctggaagagaagcttgcgctctccttgagtaactcggcg
gccattgcactgtatgtgaataattacgatattgcctccgaggtgatggatgcgttgctg
cttcatcaagagatcaatgcggttaagttagccagcgtggatggcattgtctttgagcgc
accaccatcccctcaacctacaaagagcagaattattggagtgatgcgaaccgctaccga
ttagattctcccgtagatggtaatttgattggctatctgatgattcatgaggatcatcag
gtgattcgtcagcaagccattaatcagattcttgatcagatagccgtggttttgatccag
tttctcgtgacttttattgcgcttatctggatcgttcgccgcttggtcggtaaacccctg
acggatctttcacaggcgttatccgaagtgcggccagatcatgatcgcaaagtggcggta
gccgcagaagatcaccacaacgagattggtttggtggccaaaagcatcaatgaatttatc
gacgcttcccatcaagctttactgcgtgaacgcgagctgcgtcaacagattgaacgttgg
gaaagctactatcgcaccattgccgaacaagacacgctgacgggactaaaaaaccgttta
ggttgtgagaagttcgtgctccgcaaacagcgtgctagcaccactatggtgctgctattg
attgatttggatggttttaagcaggtgaatgataccttggggcatgcggctggcgatgag
gtattacgtgaaatcgccaaacgtttttatgccttggcgcaaacacatttttctgatttt
gtggtcggacggctcggtggtgatgagtttgctatttacattccgctggatgaatttgtt
gccgaatctatcgagcggtttgcggctcagttgatcgaatcctcctctgagccgattgga
ttgggtcagcagagtgcgcaagtgggttgcagtatcgggattagtcatatgaacagtctg
cacattgacttagaaaaactgctgctacaagccgataaagccatgtactgggtcaaatac
agaggcaaacatggctatcatatttatcgaatgggggaagagatcctgcctcttcccagt
gcgaaagaactcaagcaggatcagttcagatag

DBGET integrated database retrieval system