KEGG   Vibrio cholerae O1 biovar El Tor FJ147: IR04_18305Help
Entry
IR04_18305        CDS       T03827                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vcf  Vibrio cholerae O1 biovar El Tor FJ147
Pathway
vcf00620  Pyruvate metabolism
vcf00680  Methane metabolism
vcf01100  Metabolic pathways
vcf01120  Microbial metabolism in diverse environments
vcf01200  Carbon metabolism
Module
vcf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vcf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IR04_18305
  Energy metabolism
   00680 Methane metabolism
    IR04_18305
Enzymes [BR:vcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     IR04_18305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKA01033
UniProt: A0A2L2M856
LinkDB All DBs
Position
I:2903128..2905758
Genome map
AA seq 876 aa AA seqDB search
MNEKYAALKSNVSMLGRLLGQTIQAADGDVILAKVETIRKLSKSARAGNQADRELLIEEI
KNLPNHQLTPVARAFNQFLNLTNIAEQYHTISRHCESHVNELDAIGSLFAKLAQKSVSKF
DTAQAIRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSPKERHKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWHAVPEFLRELDEQVKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHTITREVLLLSRWKAADLYLTDINELVSELSMTKCNEAVR
ALAGEEHEPYRAILKPIRSLLQETIEILDAKLNGQKLAVKAPLQTADQLWEPLYACYQSL
HECGMGVIADGSLLDTLRRIKAFGVHLVRLDVRQESSRHAEVISELTRHLGIGDYNQWSE
QDKIAFLTTELNSKRPLLPRDWQPSPQVKEVLDTCKIIAAQSKDAFGAYVISMARTASDV
LAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIRQLMNIDLYRGFIQNHQMVMIGYSD
SAKDAGVMAAGWAQYRAMEALVKVGEEAGIELTLFHGRGGTIGRGGAPAHAALLSQPPKS
LKGGLRVTEQGEMIRFKLGLPEVAVNSFNMYASAILEANLLPPPEPKNEWRALMDILSEI
SCNAYRKVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPTGGVESLRAIPWIFSWSQ
NRLILPAWLGAGEAIQIAINEGHQALLEEMCREWPFFSTRLGMLEMVYTKCSVSIACHYD
ERLVEPTLRPLGEKLRAQLQQDIKVVLNVENNENLMQSDPWGQESIRLRNIYIEPLNMLQ
AELLYRTRQSELPAPELEEALMVTIAGIAAGMRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaatacgctgcgctcaaaagtaacgtaagcatgttaggacgactactcggc
cagacaattcaagccgccgatggtgacgttattttagcgaaagtggaaaccatccgaaaa
ctttccaaatctgcccgagcgggcaaccaagcagaccgcgagctgctgatcgaagagatc
aaaaatcttcctaaccaccaactgactcccgtggctcgcgcctttaaccaattcctgaac
ctgaccaatattgccgagcagtatcacaccatctcacgccactgtgaaagccacgtgaat
gagttggatgcgattggtagcctgtttgctaaactggcgcagaagtcggtcagtaaattc
gatacggcgcaagccattcgcgatctcaacattgaactggtattgaccgctcacccgact
gagatcactcgtcgcaccatgatcaacaagctagtcaaaatcaacgaatgtctgtccaaa
cttgagctcagcgacctctctccgaaagagcgccataaaaccgagcgccgccttgagcaa
ttaattgcccaaagttggcattcagatgtgattcgtcagcagcgtccaacgccattagat
gaagccaaatgggggttcgcggtcgtagaaaactcactgtggcacgccgttcctgagttt
ttgcgtgagttagatgaacaggtgaaatcttacctaggtgaaggtttaccgattgatgca
cgccctgtgcatttctcatcttggatgggtggagatcgcgatggtaacccctttgtgacc
cacactatcactcgcgaagtgctgttactgtcacgctggaaagcagccgatttgtatctc
accgatatcaatgaactggtcagcgaactttcgatgaccaagtgtaatgaagccgtacgc
gctttagccggcgaagagcacgaaccttatcgcgccatcctcaagccaatacgaagcttg
ctgcaagagacgattgaaattcttgatgcaaaactcaacggccaaaaactggcagtaaaa
gcccctttgcaaaccgcagatcagttgtgggaaccgctctacgcgtgttaccaatcactg
catgagtgtggcatgggcgtaatcgcagatggttccttgctcgataccctgcgccgcatt
aaagcctttggcgtgcatctggttcgcctcgatgttcgtcaagagagctcacgccatgca
gaagtgatctcggaactgacccgtcatctcggcatcggcgattacaatcagtggagcgag
caagataaaatcgcgttcctgaccacagagctgaactcgaaacgcccactgctaccacgc
gattggcaaccgtcgcctcaagtcaaagaggtgttggatacctgtaagatcatcgctgcg
cagtccaaagatgcctttggcgcttatgtcatttcgatggcgcgtaccgcatcggatgtc
ctcgccgtgcacctgctgctgcaagaggcaggatgtccttatcgtatggatgtttgcccg
ctgtttgaaaccttagatgacttgaacaatgcagaatcggtgatccgtcaactgatgaac
atcgatctgtatcgcggctttattcagaaccaccaaatggtgatgattggttattccgat
tccgccaaagatgcgggggtgatggcagcaggctgggcgcaataccgagcgatggaagcg
ctagtgaaagttggcgaagaagcggggatcgaactcactctattccatggtcgcggcggc
acaattggtcgcggcggtgctcctgcacacgcggcactgctttctcagccaccaaagagt
ttgaagggcggtctgcgtgtaaccgaacaaggcgaaatgatccgctttaaactgggtcta
cctgaagtggcggtcaacagctttaacatgtacgccagcgctattttggaagccaactta
ctacccccaccagagcctaaaaatgagtggcgtgcgctgatggatattctgtcggaaatt
tcatgtaatgcttaccgaaaagtcgtgcgtggtgaaccagactttgttccttacttccgt
caagccacaccagaattagaactcggcaagctgccattgggttccagacccgccaaacgt
aatcctactggtggagtcgagagcctgcgagccattccatggatcttctcatggagccag
aatcgtctcattcttcctgcttggctaggtgcgggtgaagcgatccaaattgccattaat
gaaggacaccaagcgctacttgaagagatgtgccgcgaatggccattcttctcaactcgc
cttggcatgctggaaatggtgtacaccaaatgcagtgtaagcatcgcgtgtcattatgat
gagcgacttgttgaaccgactttgcgtccattgggtgaaaaattgcgtgctcaattacag
caagacattaaagttgtgctgaacgttgagaataacgagaacctgatgcaaagcgatcct
tggggacaagagtcgattcgtctgcgtaacatctatattgaaccactcaacatgctgcaa
gcagaactgctgtatcgtacccgtcaatcagaacttcctgctccagaactggaagaagcc
ttgatggtgaccattgcgggaattgcggcgggaatgcgcaatactggttaa

DBGET integrated database retrieval system