KEGG   Vibrio cholerae O1 El Tor N16961: VC1047Help
Entry
VC1047            CDS       T00034                                 

Gene name
fadJ
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00071  Fatty acid degradation
vch00280  Valine, leucine and isoleucine degradation
vch00281  Geraniol degradation
vch00310  Lysine degradation
vch00362  Benzoate degradation
vch00380  Tryptophan metabolism
vch00410  beta-Alanine metabolism
vch00640  Propanoate metabolism
vch00650  Butanoate metabolism
vch00903  Limonene and pinene degradation
vch00930  Caprolactam degradation
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
vch01212  Fatty acid metabolism
Module
vch_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VC1047 (fadJ)
   00650 Butanoate metabolism
    VC1047 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VC1047 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC1047 (fadJ)
   00310 Lysine degradation
    VC1047 (fadJ)
   00380 Tryptophan metabolism
    VC1047 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC1047 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VC1047 (fadJ)
   00281 Geraniol degradation
    VC1047 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VC1047 (fadJ)
   00930 Caprolactam degradation
    VC1047 (fadJ)
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VC1047 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VC1047 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VC1047 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 SSTK-IP
Motif
Other DBs
NCBI-GeneID: 2614317
NCBI-ProteinID: NP_230692
UniProt: Q9KT58
LinkDB All DBs
Position
I:1116202..1118328
Genome map
AA seq 708 aa AA seqDB search
MDNNNAFQLSFDEQHYAWLAIDVPGEKMNTLQAAFAEEMQAVFATLNEKRGQIKGLIIHS
LKPDNFIAGADVRMLEACQSVHEAQALASQGQQMFQQLADLPFPVVAAIHGPCLGGGLEL
ALACDYRVCTEDEVTRLGLPEVMLGLLPGSGGTQRLPRLIGLLPALDLILTGKQLRAKKA
KKLGVVDACVPHSVLLDVAKRLLEEKGHKKRAQVTLPIKEKLLANTDLGRKLIFDQAAKK
TQQKTRGNYPAAQAILEVIQYGLEKGMHAGLEYEAKRFAELVMTRESKALRSIFFATTEM
KKDLGADAKPAPVAAVGVLGGGLMGAGISHVTVAKAKTSVRIKDVANDGVLNALNYNYKL
FDKQRQRKILTKAQLQAQMSQLSGGTGFVGFDRCDVVIEAVFEDLKLKQQMVADIEANAK
PTTIFATNTSSLPIHQIASQAQRPQNIVGLHYFSPVEKMPLVEVIPHATTSDETIATVVT
LARKQGKTPIVVKDCAGFYVNRILAPYMNEAAQVLMAGEPIEKLDAALLDFGFPVGPITL
LDEVGVDIGAKIMPILVKELGPRFQGPDVFDVLLKDNRKGRKSGKGFYTYKGSKKKEVDK
SVYKLLKLTPESKLNDKEIAMRCLLPMLNEAVRCLDEGIIRSARDGDMGAIFGIGFPPFL
GGPFRYMDTLGLTKVVEMMNQHTEKYGERFAPCDGLLTRAGLGEKFYP
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacaatgcatttcagctctcgtttgatgagcagcattacgcttggctggcg
attgatgtcccgggcgaaaaaatgaataccctgcaagcggcatttgcagaagagatgcaa
gccgtttttgcaacgctcaatgaaaagcgaggacagatcaaagggctgattatccactct
cttaagccggataactttattgcgggcgcggatgtccgcatgctggaagcttgccaatcg
gtacatgaagcacaagcgttagcctcgcaggggcaacagatgttccagcagcttgccgat
ttgcctttccctgtggtcgcggcgattcacggcccttgcttaggcggtggtttagaattg
gctctggcgtgtgattatcgtgtctgtactgaagatgaggtaacacgtctaggcttacca
gaagtgatgttaggtttgcttccgggctctggtggtacgcagcgtttaccacgtttgatt
ggtttactgcctgcgctggacctcatcttaacgggcaaacaattgcgtgccaaaaaggcc
aaaaaattgggtgtggttgatgcatgtgttccgcactcagtactgttggatgtggccaaa
cgtcttctagaagaaaaagggcacaaaaagcgcgctcaagttacgctaccgatcaaagaa
aaactgctcgccaataccgacttggggcgtaagttgatttttgaccaagcggccaagaaa
acgcagcagaaaacccgtggcaactaccccgcagcgcaagccattttagaggtcattcaa
tatggcctagaaaaagggatgcatgccggcttggaatatgaagccaagcgtttcgctgaa
ctggtgatgacccgagaatcgaaagcactgcgctccattttctttgcgaccacagagatg
aaaaaagatctcggtgcggatgccaaacccgcacctgtggcggctgtgggcgtgctcggt
ggtggtttgatgggggctggcatcagtcacgttactgtggcgaaagccaaaacatcggtg
cgcatcaaagatgtggcgaatgatggtgtgctcaatgccctcaattacaactacaagctg
tttgataagcagagacagcgcaagattttgactaaagcacagttgcaagcgcagatgtcg
cagctctcgggtgggactggctttgtgggttttgatcgctgtgatgtagtgatagaggct
gtgtttgaagacctgaaacttaagcaacaaatggtggcggatattgaagcgaatgccaaa
ccgacaacgatttttgcgaccaacacatcctcgctgccgatccatcagatcgcgagccaa
gcgcagcgtccgcaaaatattgtgggtttacattatttcagcccagttgaaaaaatgccg
ttggtggaagtgattcctcacgcgaccacctcggatgaaaccattgcgaccgtggtgaca
ttggcacgtaagcagggcaaaacaccgattgttgttaaagactgtgccggtttttatgtc
aaccgcattttagcgccttatatgaatgaagccgcgcaagtgctgatggcgggtgaacct
atcgaaaaactcgatgctgcgttactggattttggtttcccagtggggcctatcaccttg
cttgatgaagtaggggtcgatatcggagccaagatcatgccgattttggttaaagagctt
gggccgcgtttccaaggaccggacgtgtttgatgtgctgttgaaagataaccgtaaaggc
cggaaaagcggtaaaggtttctacacctacaaaggcagcaagaagaaagaagtcgataaa
tccgtttataaactgctgaagttaaccccggaatctaagctaaacgacaaagaaatcgcg
atgcgttgcttgttgcctatgctcaatgaggcggttcgttgtctcgatgaaggcattatt
cgcagtgcacgtgatggcgatatgggcgcgatttttggcatcggtttcccgccgttctta
ggtgggcctttccgttacatggacacgcttggtttaaccaaagtggtggaaatgatgaac
caacacaccgagaaatatggagagcggtttgctccatgtgacggtttgttgacgagagcg
ggattgggcgagaagttctacccctag

DBGET integrated database retrieval system