KEGG   Vibrio cholerae O1 El Tor N16961: VC1149Help
Entry
VC1149            CDS       T00034                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00250  Alanine, aspartate and glutamate metabolism
vch00410  beta-Alanine metabolism
vch00430  Taurine and hypotaurine metabolism
vch00650  Butanoate metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch02024  Quorum sensing
Module
vch_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VC1149
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VC1149
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC1149
   00430 Taurine and hypotaurine metabolism
    VC1149
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VC1149
Enzymes [BR:vch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VC1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 2614582
NCBI-ProteinID: NP_230794
UniProt: Q9KSV7
LinkDB All DBs
Position
I:complement(1220318..1221964)
Genome map
AA seq 548 aa AA seqDB search
MVSEHKSAQVNFDSLLKIFTVPEGPDSTLTKIDEELSRNLNHFLRKHIVAEEKPLKEIEK
DFSNAHIPEQPQFVSDHTQYLLDTLVSHSVHTASPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMIHRLIYGETDHFYQQWMHSAEHSLGAFCSGGTIANITA
LWVARNNALKAEGDFPGVEKAGLFKAMRHYGHEGLAILVSERGHYSLKKAADVLGIGQEG
LVAVKTDAHNRICPHDLEQKITELKANKIKVFAVVGVAGTTETGNIDPLRTIAQICQREQ
IHFHIDAAWGGATLMSNRYRGLLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPNAMRSI
EHHAQYILRQGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYQLLIDQSIEKARYFADL
IDAQTDFELVSQPELCLLTYRYLPEHVRMALEKSQGVQRAQLNELLNELTKFIQKKQRET
GKSFVSRTQLNPHQWDKLATIVFRVVLANPLTTKEILHNVLDEQREIAQQAPKLMRQIEH
LTQCILNQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacacaaatccgcgcaagtcaacttcgattctctgctcaagatcttcacc
gtaccggaaggtccagactcaacattaactaaaatcgatgaagagctttctcgcaattta
aaccacttcttgcgcaaacacattgtggcagaagaaaagccgctcaaagagattgagaaa
gatttttccaacgcgcacattcccgaacagcctcaattcgtttccgatcatacccaatat
ttactggatactctggtgtcacactcagtgcacaccgcatcgcccagttttattggccac
atgacatcggcactgccctacttcctgatgccgctgtcaaaaattatgatcgctctcaac
cagaatctggtcaaaattgaaacctcgaaggcattcacgccgctagagcgtcaagtgcta
ggcatgatccatcgcttgatttatggcgagacggatcacttctatcaacagtggatgcac
agtgctgagcactcactcggcgctttctgctcaggcggaaccatagccaacattacggca
ctttgggttgctcgtaataatgcgcttaaagcagaaggcgatttccccggcgttgaaaaa
gctgggctcttcaaagccatgcgccactacggtcatgaaggtttagccattttggtttcc
gaacgaggccactactcgttgaaaaaagcggccgatgtgctgggtataggccaagaaggc
ttggtcgcggtcaaaaccgatgcgcataaccgtatctgcccacacgatctagagcagaaa
atcaccgagttaaaagccaataagatcaaagtgtttgccgttgtcggagtcgccggcacc
acagaaaccggcaatattgacccactgcgcaccattgctcagatttgtcagcgtgaacag
atccacttccatatcgatgcggcttggggcggcgcgacgttaatgtcaaaccgttatcga
ggactgcttgatggtgtcgagttggccgattcagtgaccattgatgctcataagcagctc
tacatccctatgggtgcgggtatggtcttgtttaaagacccgaatgcgatgcgctcaatt
gagcatcatgcccagtacattttgcgtcaaggctctaaagatttgggtagccatacccta
gaaggatcacgctcaggcatggcgatgttggtttacgccagcatgcacatcattagccgc
ccaggctatcagctacttatcgatcaaagtattgaaaaagcgcgatattttgccgacctg
attgatgcgcaaactgactttgagttggtttcgcaaccggaactctgcttgttgacttat
cgctatctacccgagcatgtccgcatggcgctagaaaaatcgcaaggggtacagcgtgcg
cagttgaatgagctactgaacgaactcactaagtttattcagaagaaacaaagggaaacg
ggtaaatcctttgtgtcacgtacccaactcaatccacaccaatgggataaattggcaacc
atagtcttccgagtggtattggccaacccgctgacgaccaaagaaattttgcataacgtg
ctggatgaacaacgagaaatcgcgcaacaagcgccaaagttgatgcgtcaaatcgaacat
ctaacccaatgcattctgaaccaataa

DBGET integrated database retrieval system