KEGG   Vibrio cholerae O1 El Tor N16961: VC1583Help
Entry
VC1583            CDS       T00034                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VC1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FlgD_ig
Motif
Other DBs
NCBI-GeneID: 2613837
NCBI-ProteinID: NP_231223
UniProt: Q9KRQ3
LinkDB All DBs
Position
I:complement(1695314..1695829)
Genome map
AA seq 171 aa AA seqDB search
MNQFTLFAVVAFFSSSVLAQEMTVVMTDLSSGQSVGTVTVTDSEYGTVFTPQLTGLPAGL
HGFHVHANGSCETSSKDGKTVLGGAAGGHYDPQNTGKHGYPWTNDNHLGDLPALYVDAQG
QANQPVLASRFKMAEVKGKALMVHAGGDNHSDHPMPLGGGGARIVCGVIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatttactttgtttgctgtcgtcgctttcttctcttcttcggttttggctcaa
gaaatgactgtggtgatgacggatttgagctctggccaatccgtgggcaccgtgaccgta
actgatagcgagtatggtacggtctttactccgcagttaactggcttgccagccggtttg
cacggttttcatgtacacgcgaatggctcatgtgaaacctcgtccaaagatggcaaaacc
gtattaggtggcgctgcgggtgggcattatgatccgcaaaacacgggaaaacacggctat
ccgtggaccaacgacaatcacttgggtgatctcccagctttgtacgtggatgcgcaaggc
caagcaaatcaacccgttttggcatcccgcttcaaaatggcagaggtaaaaggtaaagct
ttgatggtccacgcgggcggggataaccattccgaccatccaatgcctttgggtggcggt
ggtgcgcgcatcgtatgtggtgtgattggtttataa

DBGET integrated database retrieval system