KEGG   Vibrio cholerae O1 El Tor N16961: VC1784Help
Entry
VC1784            CDS       T00034                                 

Definition
(RefSeq) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00511  Other glycan degradation
vch05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    VC1784
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VC1784
 09160 Human Diseases
  09167 Infectious diseases
   05110 Vibrio cholerae infection
    VC1784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:vch02042]
    VC1784
Enzymes [BR:vch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     VC1784
Bacterial toxins [BR:vch02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   VC1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sial-lect-inser BNR_2 BNR BNR_3
Motif
Other DBs
NCBI-GeneID: 2613664
NCBI-ProteinID: NP_231419
UniProt: P0C6E9
LinkDB All DBs
Structure
PDB: 

Position
I:1933231..1935654
Genome map
AA seq 807 aa AA seqDB search
MSIKMTSQRRRASIHKETDSNIKGVDMRFKNVKKTALMLAMFGMATSSNAALFDYNATGD
TEFDSPAKQGWMQDNTNNGSGVLTNADGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGW
RMTTEMKVLSGGMITNYYANGTQRVLPIISLDSSGNLVVEFEGQTGRTVLATGTAATEYH
KFELVFLPGSNPSASFYFDGKLIRDNIQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQ
GDVIFRGPDRIPSIVASSVTPGVVTAFAEKRVGGGDPGALSNTNDIITRTSRDGGITWDT
ELNLTEQINVSDEFDFSDPRPIYDPSSNTVLVSYARWPTDAAQNGDRIKPWMPNGIFYSV
YDVASGNWQAPIDVTDQVKERSFQIAGWGGSELYRRNTSLNSQQDWQSNAKIRIVDGAAN
QIQVADGSRKYVVTLSIDESGGLVANLNGVSAPIILQSEHAKVHSFHDYELQYSALNHTT
TLFVDGQQITTWAGEVSQENNIQFGNADAQIDGRLHVQKIVLTQQGHNLVEFDAFYLAQQ
TPEVEKDLEKLGWTKIKTGNTMSLYGNASVNPGPGHGITLTRQQNISGSQNGRLIYPAIV
LDRFFLNVMSIYSDDGGSNWQTGSTLPIPFRWKSSSILETLEPSEADMVELQNGDLLLTA
RLDFNQIVNGVNYSPRQQFLSKDGGITWSLLEANNANVFSNISTGTVDASITRFEQSDGS
HFLLFTNPQGNPAGTNGRQNLGLWFSFDEGVTWKGPIQLVNGASAYSDIYQLDSENAIVI
VETDNSNMRILRMPITLLKQKLTLSQN
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaatcaagatgacttcacaacgaagaagagcatcgattcacaaggaaacagattct
aatataaagggagtagatatgcgtttcaaaaacgtaaagaaaaccgctttaatgcttgca
atgttcggtatggcgacaagctcaaacgccgcactttttgactataacgcaacgggtgac
actgagtttgacagtccagccaaacagggatggatgcaagacaacacgaataatggcagc
ggcgttttaaccaatgcagatggaatgcccgcttggttggtgcaaggtattggagggaga
gctcaatggacatattctctctctactaatcaacatgcccaagcatcaagtttcggttgg
cgaatgacgacagaaatgaaagtgctcagtggtggaatgatcacaaactactacgccaac
ggcactcagcgtgtcttacccatcatttcattagatagcagtggtaacttagttgttgag
tttgaagggcaaactggacgcaccgttttggcaaccggcacagcagcaacggaatatcat
aaatttgaattggtattccttcctggaagtaacccatccgctagcttttacttcgatggc
aaactcattcgtgacaacatccagccgactgcatcaaaacaaaatatgatcgtatggggg
aatggctcatcaaatacggatggtgtcgccgcttatcgtgatattaagtttgaaattcaa
ggcgacgtcatcttcagaggcccagaccgtataccgtccattgtagcaagtagcgtaaca
ccaggggtggtaaccgcatttgcagagaaacgtgtggggggaggagatcccggtgctctg
agtaataccaatgacataatcactcgtacctcacgagatggcggtataacttgggatacc
gagctcaacctcactgagcaaatcaatgtcagtgatgagtttgatttctccgatcctcgg
cctatctatgatccttcctccaatacggttcttgtctcttatgctcgatggccgaccgat
gccgctcaaaacggagatcgaataaaaccatggatgccaaacggtattttttacagcgtc
tatgatgttgcatcagggaactggcaagcgcctatcgatgttaccgatcaggtgaaagaa
cgcagtttccaaatcgctggttggggtggttcagagctgtatcgccgaaataccagccta
aatagccagcaagactggcaatcaaacgctaagatccgaattgttgatggtgcagcgaac
cagatacaagttgccgatggtagccgaaaatatgttgtcacactgagtattgatgaatca
ggtggtctagtcgctaatctaaacggtgttagtgctccgattatcctgcaatctgaacac
gcaaaggtacactctttccatgactacgaacttcaatattcggcgttaaaccacaccaca
acgttattcgtggatggtcagcaaatcacaacttgggctggcgaagtatcgcaggagaac
aacattcagtttggtaatgcggatgcccaaattgacggcagactgcatgtgcaaaaaatt
gttctcacacagcaaggccataacctcgtggagtttgatgctttctatttagcacagcaa
acccctgaagtagagaaagaccttgaaaagcttggttggacaaaaattaaaacgggcaac
accatgagtttgtatggaaatgccagtgtcaacccaggaccgggtcatggcatcaccctt
actcgacaacaaaatatcagtggcagccaaaacggccgcttgatctacccagcgattgtg
cttgatcgtttcttcttgaacgtcatgtctatttacagtgatgatggcggttcaaactgg
caaaccggttcaacactccctatcccctttcgctggaagagttcgagtatcctagaaact
ctcgaacctagtgaagctgatatggttgaactccaaaacggtgatctactccttactgca
cgccttgattttaaccaaatcgttaatggtgtgaactatagcccacgccagcaatttttg
agtaaagatggtggaatcacgtggagcctacttgaggctaacaacgctaacgtctttagc
aatatcagtactggtaccgttgatgcttctattactcggttcgagcaaagtgacggtagc
catttcttactctttactaacccacaaggaaaccctgcggggacaaatggcaggcaaaat
ctaggcttatggtttagcttcgatgaaggggtgacatggaaaggaccaattcaacttgtt
aatggtgcatcggcatattctgatatttatcaattggattcggaaaatgcgattgtcatt
gttgaaacggataattcaaatatgcgaattcttcgtatgcctatcacattgctaaaacag
aagctgaccttatcgcaaaactaa

DBGET integrated database retrieval system