KEGG   Vibrio cholerae O1 El Tor N16961: VC2249Help
Entry
VC2249            CDS       T00034                                 

Gene name
fabZ
Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00061  Fatty acid biosynthesis
vch00780  Biotin metabolism
vch01100  Metabolic pathways
vch01212  Fatty acid metabolism
Module
vch_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VC2249 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VC2249 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vch01004]
    VC2249 (fabZ)
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     VC2249 (fabZ)
Lipid biosynthesis proteins [BR:vch01004]
 Fatty acid synthase
  Component type
   VC2249 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-GeneID: 2613171
NCBI-ProteinID: NP_231880
UniProt: Q9KPW3
LinkDB All DBs
Position
I:complement(2403985..2404446)
Genome map
AA seq 153 aa AA seqDB search
MMTLTTDKKTMNITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQ
LPVFPGVLILEAMAQATGLLAFKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMVEVEF
LKERRGIALFNGVAKVDGDVVCSAQLKCARREF
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgatgactttgactactgataagaaaacgatgaatatcactgaaattcaatcgcttctg
cctcaccgctatccatttttactgattgatcgcgtgaccgactatgaagaaggtaagtac
ctgattggtttgaaaaatgtttcagtgaatgagcctcagtttacgggtcactttccacaa
ctgccggttttccccggtgtattgattttagaagccatggctcaagccactggtctgttg
gcgttcaaaacctttggtgcgccaaaagagaatgaactgtactattttgccagcattgat
gaagctaagttccgtaagccagtgacaccgggcgatcaactgatggttgaagttgaattc
cttaaagagcgtcgtggtatcgcgctgtttaacggcgtggccaaagtcgatggtgatgtg
gtctgttctgctcaactgaaatgcgcacgtcgagagttttaa

DBGET integrated database retrieval system