KEGG   Vibrio cholerae O1 El Tor N16961: VC2413Help
Entry
VC2413            CDS       T00034                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00010  Glycolysis / Gluconeogenesis
vch00020  Citrate cycle (TCA cycle)
vch00620  Pyruvate metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
Module
vch_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC2413 (aceF)
   00020 Citrate cycle (TCA cycle)
    VC2413 (aceF)
   00620 Pyruvate metabolism
    VC2413 (aceF)
Enzymes [BR:vch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VC2413 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-GeneID: 2613082
NCBI-ProteinID: NP_232043
UniProt: Q9KPF5
LinkDB All DBs
Position
I:complement(2582987..2584894)
Genome map
AA seq 635 aa AA seqDB search
MKVGKVMAIEIYVPDIGADEVEVTEILVKVGDKVAEEQSLITVEGDKASMEVPASQAGIV
KEIKVVAGDKVSTGSLIMVFEAEGAAAAAPAPAPQAAAPVAAAPAAAALKEVQVPDIGGD
EVEVTEIMVKVGDVVAEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMV
FEVAGAAPLAAPVQAAAPAAAAAPAVAALKEVQVPDIGGDEVTVTEIMVNVGDSISEEQS
LITVEGDKASMEVPAPFAGTLKEIKVATGDKVKTGSLIMVFEVAGAAPVAAPVQAAAAPA
AAPAQAATPAAAAPATSGEFQENHEYSHASPVVRRLAREFGVNLAKVKGSGRKNRILKED
VQNYVKEALKRLESGAQAAASGKGDGAALGLLPWPKVDFSKFGDTEVQPLSRIKKISGAN
LHRNWVMIPHVTQWDNADITELEKFRQEQNAMEAKRDTGMKITPLVFIMKAAAKALEAFP
AFNSSLSDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSKELAEVSKKARG
GKLTAADMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPVWNGKEFAPRLQL
PLSLSYDHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtaggaaaagtaatggcaatcgaaatttatgtacctgacatcggtgcggatgag
gttgaagtcactgagattctcgtcaaagtcggcgacaaagtggctgaagagcaatctctg
atcacggttgaaggcgacaaagcttctatggaagttcctgcgtctcaagcgggtatcgtt
aaagagatcaaagtagtggcaggtgacaaagtgtctactggctctctgatcatggtcttt
gaagcggaaggtgcagcagcggcagcaccagctcctgcgcctcaagcggcagcaccagtt
gctgcggctccagcggcagctgcactgaaagaagtgcaagtaccagacattggcggtgat
gaagttgaagtgactgaaatcatggtcaaagtgggcgatgtggttgcggaagagcaatct
ctgatcaccgttgaaggcgacaaagcgtcaatggaagtacctgcacctttcgctggtacg
gttaaagagatcaaaatcgctgcgggcgacaaagtatcaacaggttcactgatcatggtg
tttgaagtagccggcgctgcgccacttgcagcacccgttcaagctgcggcaccagcggca
gctgctgctccggccgttgcagcactgaaagaagttcaagtacctgatatcggcggtgac
gaagtgaccgtaacggaaatcatggttaacgtgggcgacagcatcagcgaagagcaatct
ctgatcaccgtagaaggcgataaagcttctatggaagtacctgcaccttttgccggaact
ctgaaagagatcaaagtggctacaggcgataaagtgaaaacaggttcgctgatcatggtg
tttgaagttgctggcgcagcgccagtcgcggcaccagttcaagcagcagcagcacctgcg
gcagcgcctgctcaagcagcgactcctgcggcggctgcacctgcaacaagtggtgaattc
caagaaaaccatgagtactcacatgcttctccagtcgtgcgtcgtctggctcgtgaattt
ggcgttaacctagccaaagtcaaaggctctggccgtaagaaccgtatcctgaaagaagac
gtacagaactacgtgaaagaagcgctgaaacgtctggaatctggcgcgcaagcggcggct
tcaggtaaaggtgatggcgcagcgctgggcttactgccttggccaaaagtggacttcagc
aagttcggtgataccgaagtgcaaccactgtctcgcatcaagaaaatctcgggtgctaac
ctgcaccgtaactgggtgatgatcccgcacgtgacccaatgggacaatgcagacatcact
gagctagagaaattccgtcaagagcaaaacgcgatggaagcgaagcgcgacacaggtatg
aagatcactccgctggtgttcatcatgaaagccgctgcgaaagcgctggaagctttccct
gcgttcaactcttctctgtctgacgacggcgaaagcttgatcctgaagaaatacgtgaac
atcggtatcgcagtggatacaccaaatggtctggtggttcctgtgtttaaagatgtgaac
aagaaaggtatctacgagctgtcaaaagagctggctgaagtctcgaagaaagcccgtggc
ggtaagctgactgccgctgacatgcaaggtggctgtttcactatctctagcctaggtggc
attggcggtacagcgtttaccccaatcgttaacgcacctgaagtggctattttgggtgtg
tctaagtctgagatgaagccagtgtggaacggcaaagagttcgcgccacgtctgcaactg
ccactgtcactgtcttacgatcaccgcgtgatcgacggtgcagaaggtgcacgcttcatt
acttacctgaacgagtgtctaagcgacatccgtcgtctggtactgtaa

DBGET integrated database retrieval system