KEGG   Vibrio cholerae O1 IEC224: O3Y_02575
Entry
O3Y_02575         CDS       T01766                                 

Gene name
alaS
Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vci00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    O3Y_02575 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vci01007]
    O3Y_02575 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vci03016]
    O3Y_02575 (alaS)
Enzymes [BR:vci01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     O3Y_02575 (alaS)
Amino acid related enzymes [BR:vci01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   O3Y_02575 (alaS)
Transfer RNA biogenesis [BR:vci03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    O3Y_02575 (alaS)
 Prokaryotic type
    O3Y_02575 (alaS)
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD TMF_DNA_bd
Other DBs
NCBI-ProteinID: AFC57398
LinkDB
Position
I:576187..578769
AA seq 860 aa
MFMSTDEVRRAFLSFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDCFLGLEKRAYT
RATTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKEDAIQYAWEFLTDVLQ
LPKERLLVTVYETDDEAFDIWNKKVGIPADRIIRIGDKKGGKKFDSDNFWQMGDTGPCGP
CTEIFYDHGDHIWGGPPGSPEEDGDRFIEIWNNVFMQFNRHADGTMEPLPKPSVDTGMGI
ERISAIMQGVHSNYEIDVFQTLIKAAADAIGYQDLTNQSLRVVADHIRSCAFLIVDGVMP
SNEGRGYVLRRIIRRAVRHGNKLGAQGAFFHKLVGPLAEVMGTAGVELKKQQALVEKVLR
IEEENFGRTLDRGMSILNDALDQLSGQVLDGETVFKLYDTYGFPADLTNDVARERGFSID
EAGFEQAMEEQRQRAREAGQFGTDYNSLIKSATNTEFCGYTASRGQSVVREMFVEGAEVS
TLSAGDKAIIVLDNTPFYAESGGQCGDTGVLKTDAGIFHVEDTQKLGNAIAHHGVIAQGV
LATGDQVDAIVDEKRRAAISLNHSATHLLHAALRKVLGEHVAQKGSLVRAETLRFDFSHL
EAMTAAEIKEVERLVNQEVRRNHSIETNIMNIDEAKAKGAMALFGEKYDDQVRVLSMGDF
STELCGGIHASNTGDIGLFKIISEGGIAAGIRRIEAVTGEGALDYLDAQQAQHDAKVSEM
AAKAKLLEKEIQQLKDKLAAKESAGLINQVKQIAGVNVLVAQLNGADNKALRGMVDDLKN
QLSSGIIMLGNVAEGKVGLIAGVTNDLTNKVKAGELVNMVALQVGGKGGGRPDMAQAGGT
DAHALPSALESVDAWIAERL
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgtttatgagcacggatgaggtgcgccgcgcgttcctctcattctttgaaagcaaaggt
caccaaattgtagaaagttcttctctggtgcctgctaacgatccgaccctgttgtttacc
aacgcagggatgaaccaatttaaagactgtttcttgggcttggaaaagcgcgcctacact
cgcgccacgaccgctcaacgttgtgtccgcgcgggcggtaagcacaacgacctagaaaac
gtcggtttcaccgcacgtcaccacactttcttcgaaatgctgggtaacttcagtttcggt
gactatttcaaagaagatgcgatccagtatgcatgggagtttctgactgacgttctgcaa
ctgccgaaagagcgcttgttagtcacggtttatgaaaccgatgacgaagcctttgatatt
tggaataaaaaagtcggcattcctgctgaccgcattattcgtatcggcgataaaaaaggt
ggcaagaagttcgattcggataacttctggcagatgggtgacaccggtccttgcggtcca
tgtactgaaatcttctacgaccacggtgaccacatttggggtggacctccaggctcacct
gaggaagatggcgatcgtttcatcgaaatctggaacaacgttttcatgcagttcaaccgt
catgcggatggcacgatggagccgctacctaagccgtctgtggacacgggcatgggtatt
gagcgtatttccgcgatcatgcaaggcgtgcactccaactacgaaatcgacgtattccaa
acgctgatcaaagcagccgcagacgcaattggttaccaagatctgactaatcagtctctg
cgcgttgtcgcggatcacatccgttcatgtgcctttttgattgtggatggcgtgatgccg
tctaacgaaggtcgtggttatgtactgcgtcgtatcattcgtcgtgccgttcgtcatggc
aataagctcggtgcgcaaggtgcattcttccacaagttggtgggaccattggcggaagtg
atgggtactgcaggcgttgagctgaaaaagcagcaagctctggttgaaaaagtgctacgt
atcgaagaagaaaactttggacgtacgctggatcgcggcatgagcattctgaatgacgcg
ctggatcaactatcaggccaagtgctggatggtgaaaccgtcttcaaactctacgacacc
tacggcttccctgcggatttaaccaatgatgtggcgcgtgagcgtggctttagcattgat
gaagcgggttttgaacaagcgatggaagagcagcgtcaacgcgctcgtgaggctggccaa
tttggtacggattataattcgctgatcaaatccgccaccaataccgaattctgcggttac
acggcgagtcgtggccaaagtgtggttcgcgaaatgttcgtggagggcgcggaagtttct
acgctgtcagctggtgataaagccatcatcgtactagacaacacgccattctacgcagaa
tcaggtggtcaatgcggcgatactggcgttttgaaaaccgacgcaggtattttccatgtt
gaagatactcaaaaattaggtaacgcgattgcgcatcacggtgtgatcgcccaaggcgta
ttggcgacaggcgatcaggtggatgccatcgtcgatgaaaagcgccgtgcggcaatttcg
ctgaaccactcggcgactcacttgttgcatgctgcactacgtaaagtgctgggtgaacac
gtggcgcagaaaggctctctagtgcgtgctgaaacactgcgttttgacttctcacatctg
gaagcgatgaccgctgcagagattaaagaagtagaacgtttagtgaaccaagaagttcgt
cgtaaccacagtatcgaaaccaacatcatgaatattgatgaagcgaaagcgaaaggtgcg
atggcgctgtttggtgagaaatatgacgaccaagttcgtgtgctctcaatgggagatttc
tcaactgagctgtgtggtggtatccacgcgagcaacacgggtgatattggtctgtttaag
atcatctctgaaggtggtattgctgcgggtattcgccgtattgaagcggtgactggtgaa
ggcgcattagattacctcgatgcacagcaagcacagcatgatgccaaagtgtctgaaatg
gcggcaaaagccaaactgctggagaaagagatccaacagttgaaagataagctggcggcg
aaagagagcgcgggtcttatcaaccaagttaagcagatcgcgggtgttaacgtactggtt
gcgcagctcaacggtgcagacaacaaagcgctacgtggcatggtagatgatctcaaaaac
caattaagcagcggcatcatcatgctgggtaatgtggctgaaggcaaagttggcctaatt
gcgggcgtaaccaacgatttgaccaataaagtcaaagcgggtgagctggtcaacatggtc
gcactacaagtcggtggtaagggtggtggccgccctgacatggctcaagctggagggaca
gatgctcacgctctgccatcggccttagagtctgtcgacgcttggattgccgagcgtcta
taa

DBGET integrated database retrieval system