KEGG   Vibrio cholerae O1 IEC224: O3Y_10210Help
Entry
O3Y_10210         CDS       T01766                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01130  Biosynthesis of antibiotics
vci01230  Biosynthesis of amino acids
Module
vci_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3Y_10210
Enzymes [BR:vci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     O3Y_10210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt STAT_int ChaB
Motif
Other DBs
NCBI-ProteinID: AFC58916
LinkDB All DBs
Position
I:complement(2318535..2319620)
Genome map
AA seq 361 aa AA seqDB search
MAGNSIGQHFRVTTFGESHGIALGCIVDGCPPGLTISEADLQVDLDRRRPGTSRYTTQRR
EPDEVKILSGVFEGKTTGTSIGLLIENTDQRSKDYSDIKDKFRPGHADYTYHQKYGVRDY
RGGGRSSARETAMRVAAGAIAKKYLQQEFGIEVRAYLSQMGEVAIDKVDWNEIENNDFFC
PDVDKVAAFDELIRELKKEGDSIGAKIQVVATGVPVGLGEPVFDRLDADIAHALMSINAV
KGVEIGDGFDVVRQKGSQHRDPLTPQGFRSNHSGGILGGISSGQDIVANIALKPTSSITV
PGETIDVNGEPTELITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRGQNQGVVTTTPK
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaacagtatcggacaacatttccgagtcaccacattcggagaaagtcacggt
atcgcactgggatgtattgtcgatggttgcccaccggggctcaccatcagcgaagcggat
ttacaagtggatcttgaccgtcgtcgccccggcacatcgcgttataccacccagcgtcgc
gagccggatgaagtcaaaattctctctggtgtgtttgagggcaaaaccacaggcacatcg
attgggctattgatcgaaaacactgaccaacgctctaaagattattcggatattaaagac
aaattccgtcccggacatgcggactacacctatcatcaaaagtacggtgtgcgagattac
cgtggcggcggccgttcatcggcacgtgaaaccgccatgcgtgttgcggcgggagcgatt
gccaaaaaatacctgcagcaagagtttggcattgaagtgcgtgcttacttgtcgcaaatg
ggggaggtcgcgattgataaagtggattggaatgagattgaaaacaacgatttcttctgc
cctgatgtcgataaagtggctgcgtttgacgagctgatccgcgagctgaaaaaagaaggc
gattcgatcggcgccaaaatccaagtggttgctactggcgttccagttggcttgggtgag
cctgtgtttgatcgcttagatgcggatattgcccatgccttgatgagcatcaacgccgtg
aaaggagtcgagattggtgatggctttgatgtagtgcgccaaaaaggcagccaacatcgt
gacccgctcactccacaaggtttccgctctaaccattccggtggcattttaggcggtatc
tctagcgggcaagatattgttgctaatattgcgttgaagccaacgtccagcattaccgtg
ccgggtgaaacaattgatgttaacggtgagccaaccgagcttatcaccaaaggtcgtcat
gacccttgtgtggggattcgcgctgtaccgattgcagaagccatgttggcgattgtgctg
atggatcatctgctgcgtcatcgtggtcagaaccaaggtgtcgtaacgacaacaccgaaa
atttag

DBGET integrated database retrieval system