KEGG   Vibrio cholerae IEC224: O3Y_11555Help
Entry
O3Y_11555         CDS       T01766                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00010  Glycolysis / Gluconeogenesis
vci00020  Citrate cycle (TCA cycle)
vci00620  Pyruvate metabolism
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01120  Microbial metabolism in diverse environments
vci01130  Biosynthesis of antibiotics
vci01200  Carbon metabolism
Module
vci_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3Y_11555 (aceF)
   00020 Citrate cycle (TCA cycle)
    O3Y_11555 (aceF)
   00620 Pyruvate metabolism
    O3Y_11555 (aceF)
Enzymes [BR:vci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     O3Y_11555 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFC59181
LinkDB All DBs
Position
I:complement(2629286..2631175)
Genome map
AA seq 629 aa AA seqDB search
MAIEIYVPDIGADEVEVTEILVKVGDKVAEEQSLITVEGDKASMEVPASQAGIVKEIKVV
AGDKVSTGSLIMVFEAEGAAAAAPAPAPQAAAPVAAAPAAAALKEVQVPDIGGDEVEVTE
IMVKVGDVVAEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMVFEVAGA
APLAAPVQAAAPAAAAAPAVAALKEVQVPDIGGDEVTVTEIMVNVGDSISEEQSLITVEG
DKASMEVPAPFAGTLKEIKVATGDKVKTGSLIMVFEVAGAAPVAAPVQAAAAPAAAPAQA
ATPAAAAPATSGEFQENHEYSHASPVVRRLAREFGVNLAKVKGSGRKNRILKEDVQNYVK
EALKRLESGAQAAASGKGDGAALGLLPWPKVDFSKFGDTEVQPLSRIKKISGANLHRNWV
MIPHVTQWDNADITELEKFRQEQNAMEAKRDTGMKITPLVFIMKAAAKALEAFPAFNSSL
SDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSKELAEVSKKARGGKLTAA
DMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPVWNGKEFAPRLQLPLSLSY
DHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaatttatgtacctgacatcggtgcggatgaggttgaagtcactgagatt
ctcgtcaaagtcggcgacaaagtggctgaagagcaatctctgatcacggttgaaggcgac
aaagcttctatggaagttcctgcgtctcaagcgggtatcgttaaagagatcaaagtagtg
gcaggtgacaaagtgtctactggctctctgatcatggtctttgaagcggaaggtgcagca
gcggcagcaccagctcctgcgcctcaagcggcagcaccagttgctgcggctccagcggca
gctgcactgaaagaagtgcaagtaccagacattggcggtgatgaagttgaagtgactgaa
atcatggtcaaagtgggcgatgtggttgcggaagagcaatctctgatcaccgttgaaggc
gacaaagcgtcaatggaagtacctgcacctttcgctggtacggttaaagagatcaaaatc
gctgcgggcgacaaagtatcaacaggttcactgatcatggtgtttgaagtagccggcgct
gcgccacttgcagcacccgttcaagctgcggcaccagcggcagctgctgctccggccgtt
gcagcactgaaagaagttcaagtacctgatatcggcggtgacgaagtgaccgtaacggaa
atcatggttaacgtgggcgacagcatcagcgaagagcaatctctgatcaccgtagaaggc
gataaagcttctatggaagtacctgcaccttttgccggaactctgaaagagatcaaagtg
gctacaggcgataaagtgaaaacaggttcgctgatcatggtgtttgaagttgctggcgca
gcgccagtcgcggcaccagttcaagcagcagcagcacctgcggcagcgcctgctcaagca
gcgactcctgcggcggctgcacctgcaacaagtggtgaattccaagaaaaccatgagtac
tcacatgcttctccagtcgtgcgtcgtctggctcgtgaatttggcgttaacctagccaaa
gtcaaaggctctggccgtaagaaccgtatcctgaaagaagacgtacagaactacgtgaaa
gaagcgctgaaacgtctggaatctggcgcgcaagcggcggcttcaggtaaaggtgatggc
gcagcgctgggcttactgccttggccaaaagtggacttcagcaagttcggtgataccgaa
gtgcaaccactgtctcgcatcaagaaaatctcgggtgctaacctgcaccgtaactgggtg
atgatcccgcacgtgacccaatgggacaatgcagacatcactgagctagagaaattccgt
caagagcaaaacgcgatggaagcgaagcgcgacacaggtatgaagatcactccgctggtg
ttcatcatgaaagccgctgcgaaagcgctggaagctttccctgcgttcaactcttctctg
tctgacgacggcgaaagcttgatcctgaagaaatacgtgaacatcggtatcgcagtggat
acaccaaatggtctggtggttcctgtgtttaaagatgtgaacaagaaaggtatctacgag
ctgtcaaaagagctggctgaagtctcgaagaaagcccgtggcggtaagctgactgccgct
gacatgcaaggtggctgtttcactatctctagcctaggtggcattggcggtacagcgttt
accccaatcgttaacgcacctgaagtggctattttgggtgtgtctaagtctgagatgaag
ccagtgtggaacggcaaagagttcgcgccacgtctgcaactgccactgtcactgtcttac
gatcaccgcgtgatcgacggtgcagaaggtgcacgcttcattacttacctgaacgagtgt
ctaagcgacatccgtcgtctggtactgtaa

DBGET integrated database retrieval system