KEGG   Vibrio cholerae O1 IEC224: O3Y_14723Help
Entry
O3Y_14723         CDS       T01766                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci00550  Peptidoglycan biosynthesis
vci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vci00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O3Y_14723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vci01002]
    O3Y_14723
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vci01011]
    O3Y_14723
Enzymes [BR:vci01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     O3Y_14723
Peptidases [BR:vci01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   O3Y_14723
Peptidoglycan biosynthesis and degradation proteins [BR:vci01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   O3Y_14723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AFC59765
LinkDB All DBs
Position
II:288799..289968
Genome map
AA seq 389 aa AA seqDB search
MTSTKFLVRFSMACMAFVPTLGFSALTVVPEPPQLAANGYVLIDFHTGKVLVEHNAHQKL
NPASLTKLMTSYVAGQEMKRGNIHADDQVRISNNAWAKKFPDSSKMFIEVGTYVNLMDLY
RGLIVQSGNDASVAIAEHVAGSEGAFVSLMNSWAQQLGMNNSSFANPHGLDNPALYSTPY
DIALLGRAIIRDLPEIYPLYSELSFTYNGITQHNRNGLLRDRSMNVDGMKTGYTSGAGYS
LASSATSGEMRLISVVMGSKSVKSREAESKQLLSYGFRFYETVTPHQKDTVIQNQRLWYG
DKNEVALGSADTVYLTLPRSDVKKLNAVIQLDQNLEAPIAKGDVVGSIFYYIDEEKVGEA
KLVSQESVEQGGIFKRLMDWFKLLFSGWF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccaagtttctcgtcaggttttcaatggcttgtatggcatttgtgccaacg
ttaggtttttccgctttgaccgtcgtacccgagccgccacaattggccgctaacggttat
gttctaatcgatttccatacaggtaaagttctggtcgaacacaacgcacatcaaaaactc
aatccggccagcttaaccaaactcatgacctcgtacgtcgcaggacaagagatgaagcgt
ggcaatatccatgcggatgaccaagtgcggatcagcaataacgcatgggccaagaaattt
ccagattcatcaaaaatgttcattgaagtgggcacttacgtcaatttgatggatctttac
cgcggcttgatcgtgcaatcagggaatgatgccagtgtggcgattgccgagcatgtcgct
ggatcggaaggggcgtttgtgagtctaatgaactcgtgggcgcagcaattggggatgaac
aatagctcgtttgctaaccctcacgggctggataatcccgctctgtacagcacaccctat
gacattgcgttactgggccgtgcgattattcgcgatctaccggaaatctacccgctgtac
agtgagctttcatttacttacaacggcatcactcaacacaaccgtaatggtctgctgcgc
gatcgcagtatgaatgttgacggcatgaaaacaggttacaccagtggtgcgggatatagc
ttagccagctcggccaccagtggcgagatgcgcctcatttcagtggtgatggggtcaaaa
agcgtgaagagtcgtgaggcagaaagtaaacaactgctcagttatggtttccgtttttac
gaaacggtgacaccacatcaaaaagacacggtgatccagaatcagcgtctctggtatgga
gataaaaacgaagtggcgttgggcagtgctgatactgtctacttaacactgccgcgcagc
gacgtgaaaaaactcaatgctgtgatccaattggatcaaaacctcgaagcgccgatcgcc
aaaggtgatgtagtaggctcgattttctactacattgatgaagaaaaggtcggcgaggcc
aaattggttagccaagaatctgtcgaacagggcgggatctttaaacgtctgatggattgg
ttcaagctgctcttctctggttggttttga

DBGET integrated database retrieval system