KEGG   Vibrio cholerae O1 MJ-1236: VCD_001734Help
Entry
VCD_001734        CDS       T00903                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01130  Biosynthesis of antibiotics
vcj01230  Biosynthesis of amino acids
Module
vcj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VCD_001734
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     VCD_001734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK TsaE APS_kinase ABC_tran AAA_16 AAA AAA_22 AAA_17 Ploopntkinase3 CoaE AAA_28 AAA_7 RNA_helicase AAA_25 AAA_PrkA AAA_5 AAA_24 AAA_29 IstB_IS21 RsgA_GTPase AAA_2
Motif
Other DBs
NCBI-ProteinID: ACQ59903
LinkDB All DBs
Position
1:793680..794204
Genome map
AA seq 174 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFIDSDTVIEERTGADIAWVFDVEGEEGFR
KREEAVINDLTEQQGIVLATGGGSVISKENRNRLSARGIVVYLETTIEKQLARTNRDKKR
PLLQTDCPREVLEQLAEDRNPLYEEIADITVRTDDQSAKVVANQIVKMLEEHIM
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatattttccttgttggccctatgggcgctggcaaaagcacaatt
ggtagacacctagctcaacaactgcacatggagtttatcgactctgatacggttatcgaa
gaacgtaccggagcggatatcgcatgggtgtttgatgttgaaggtgaagaaggcttccgc
aagcgcgaagaagccgttattaatgatctaaccgagcaacagggtatcgtactggcgacg
ggtggtggctcagtaattagtaaagagaaccgcaaccgactgtctgctcgcggtatcgtt
gtatacctcgaaactactatcgaaaaacaattagcacgtaccaatcgcgataaaaagcgc
ccactgctgcaaacggattgcccgcgtgaagtgctagagcaattggctgaagatcgtaat
cctctgtacgaagagattgcggacatcacggtacgcactgacgatcaaagtgcaaaagtg
gtagccaatcagatcgtaaaaatgctagaagaacacataatgtaa

DBGET integrated database retrieval system