KEGG   Vibrio cholerae O1 MJ-1236: VCD_001735Help
Entry
VCD_001735        CDS       T00903                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01130  Biosynthesis of antibiotics
vcj01230  Biosynthesis of amino acids
Module
vcj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VCD_001735
Enzymes [BR:vcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     VCD_001735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH Exonuc_VII_L
Motif
Other DBs
NCBI-ProteinID: ACQ59904
LinkDB All DBs
Structure
PDB: 

Position
1:794217..795317
Genome map
AA seq 366 aa AA seqDB search
MECKTMERITVNLGERSYPISIGAGLFANPALLSLSAKQKVVIVTNHTVAPLYAPAIISL
LDHIGCQHALLELPDGEQYKTLETFNTVMSFLLEHNYSRDVVVIALGGGVIGDLVGFAAA
CYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAR
EFAAGMAEVIKYGIIYDSAFFDWLEAQMEALYALDEQALTYAIARCCQIKAEVVAQDEKE
SGIRALLNLGHTFGHAIEAHMGYGNWLHGEAVSAGTVMAAKTAQLQGLIDASQFERILAI
LKKAHLPVRTPENMTFADFMQHMMRDKKVLAGELRLVLPTSIGTSAVVKGVPEAVIAQAI
EYCRTV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttggagtgcaaaaccatggagcggattacggtcaacttaggtgaacgtagctacccaatc
tcaatcggtgccggattgtttgccaatccggctcttctttccctctctgctaagcagaag
gtggtgatagtcaccaaccacactgtcgctccgctgtatgcgcctgcgatcatttcatta
cttgatcacatcggttgccagcatgctttgctggaactgcccgatggcgaacagtacaaa
actctcgaaaccttcaacactgtgatgagctttttgcttgagcataactacagccgtgat
gtggttgtcattgctttaggtgggggagtgattggtgatctggtcggtttcgcggcggct
tgttatcagcgtggcgttgatttcattcaaataccgaccacactgctgtcgcaggtggat
tcttcggtcggtgggaaaaccgcggtcaatcatccgctcggtaaaaacatgattggtgct
ttttatcaacccaaagcggtagtgattgatacggactgtttgactacactgcccgcccgt
gaatttgccgctggcatggcggaagtcatcaagtacggcatcatttacgactcagccttc
ttcgactggctagaagcacagatggaggccttgtacgcattggacgaacaagcgctcact
tacgcaattgcgcgctgctgccaaatcaaagccgaggtggtcgcgcaagatgagaaagag
tcgggcattcgtgcgttactcaatcttggtcacaccttcggccatgcaattgaagcacac
atgggctatggcaattggctgcacggtgaagccgtatctgcgggtacagtaatggcggcg
aaaacggctcaattacaaggccttatcgatgcatctcaatttgaacgtatcctagctata
ctgaaaaaagcgcatttgcctgtgcgaaccccagagaacatgacctttgccgatttcatg
cagcacatgatgcgcgataaaaaagtgttggcaggggaactgcgtttggtgttaccgacc
agtatcggcacgtcagcggtcgtaaaaggggtacctgaagccgtgattgcccaagcgata
gagtattgtcgcacggtgtaa

DBGET integrated database retrieval system