KEGG   Vibrio cholerae O1 MJ-1236: VCD_002322Help
Entry
VCD_002322        CDS       T00903                                 

Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
Enzymes [BR:vcj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VCD_002322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACQ60489
LinkDB All DBs
Position
1:complement(1424003..1424587)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTS
TGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFG
SSWTWLVKKADGTLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAQNLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattacccgctcttccttatgcgaaagacgcactggaaccacacatctca
gcagaaactctggatttccaccacggtaagcaccacaacacttatgtggtaaaactgaac
ggtctgatcccaggtactgagtttgaaaacaaatcactagaagagatcatcaagacctca
actggcggtattttcaacaacgctgcgcaggtttggaaccacactttctactggcactgc
ctatcaccaaacggtggtggcgagccaactggcgcagttgctgaagcaatcaatgcagca
ttcggttcttttgctgacttcaaagcaaaatttactgattcagccatcaacaacttcggt
tcatcttggacttggttggtgaaaaaagctgacggcactctggcgatcactaacacttca
aacgcagcaacaccgctgactgaagaaggtgtaacccctctgctgacggttgacctgtgg
gaacacgcgtactacatcgactaccgtaacgtacgtccagattacatgaatggtttctgg
gctctggttaactgggacttcgttgctcagaacctagcaaaataa

DBGET integrated database retrieval system