KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_A1782
Entry
VCLMA_A1782       CDS       T01871                                 

Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Brite
Enzymes [BR:vcl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VCLMA_A1782
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: AEA78985
LinkDB
Position
I:2038580..2039164
AA seq 194 aa
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTS
TGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFG
SSWTWLVKKADGTLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAQNLAK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcatttgaattacccgctcttccttatgcgaaagacgcactggaaccacacatctca
gcagaaactctggatttccaccacggtaagcaccacaacacttatgtggtaaaactgaac
ggtctgatcccaggtactgagtttgaaaacaaatcactagaagagatcatcaagacctca
actggcggtattttcaacaacgctgcgcaggtttggaaccacactttctactggcactgc
ctgtcaccaaacggtggtggcgagccaactggcgcagttgctgaagcaatcaatgcagca
ttcggttcttttgctgacttcaaagcaaaatttactgattcagccatcaacaacttcggt
tcatcttggacttggttggtgaaaaaagctgatggcactctggcgatcactaacacttca
aacgcagcaacaccgctgactgaagaaggtgtaacccctctgctgacggttgacctgtgg
gaacacgcgtactacatcgactaccgtaacgtacgtccagattacatgaatggtttctgg
gctctggttaactgggacttcgttgctcagaacctagcaaaataa

DBGET integrated database retrieval system